KEGG   Marinomonas mediterranea: Marme_0777
Entry
Marme_0777        CDS       T01449                                 

Definition
(GenBank) type VI secretion protein, VC_A0110 family
  KO
K11896  type VI secretion system protein ImpG
Organism
mme  Marinomonas mediterranea
Brite
KEGG Orthology (KO) [BR:mme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mme02044]
    Marme_0777
Secretion system [BR:mme02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Marme_0777
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: ADZ90060
UniProt: F2K2L5
Position
835953..837758
AA seq 601 aa
MSDQLLSYFERELAYVRRALDSFGSEFPDHAASMRLNQTGQEDPNISRLIDAMALLTAKT
EKRIDEQLPDVLQDLFSVLYPGYLQIIPSYTPLMVELGDDPITERVVLPKGSQASLMVKE
AECLFSLAEDLIIEPFIIKDIQAESAPFNFPTPKTVRRAESVVQITLNCSDPSVFFSQLD
FTSSSLGKDKNDHFDFYVRGFENSSRGLIDLLLLNTEAISLFDEQGNQVEIDTKRLVSRA
ADPSFNWLPNHGNHQIGFDLVREYFAYPDKAAYIRLEGLYKELSRFQSSTVTLNFFVQQL
PVEYLRLFNRQVFLLNTTPAINLYPQRGEPMRYDFTKLSIPVVADTQANNELTVVSVEKV
CEVLPTGEVELSPIYEGGYWFDDSAPKWQVRQFWDEKGRRLMDLSVSYGSEVTAQDAVVL
SMSLKVCNGRLPCLVPSYSHAESYAAVDIPGELKNVRTPTAPQYPALDNQLSWRFVAMLN
ANFSSLTQADDATRALQDVLRLSTHSIQCKVADSIKNVSYKHLVAPITIDRQSIFASGTQ
VTILIDDELLGADFAVVSNVLNGFYQQYCSFDRFMQVNVERFGSDVPGIEFEKCHGSQLC
L
NT seq 1806 nt   +upstreamnt  +downstreamnt
ttgtctgatcagctcctaagttattttgaacgtgagcttgcctacgtaaggcgtgctcta
gattctttcggtagtgagttccctgatcacgccgcgtcaatgcgtcttaaccaaacgggt
caagaagaccctaatattagtcgtttgattgacgccatggcgttgcttacagcaaaaaca
gaaaaacgtatcgatgagcaacttccagacgttctgcaagatctgtttagtgtcttgtac
cctggctaccttcaaattatcccaagttatacgcctttaatggtggaactgggtgatgac
ccgataactgaacgcgttgtgttaccaaaggggtcgcaagcatcgcttatggtgaaagag
gcggaatgtctttttagccttgctgaagatttgattatcgaacctttcattatcaaagac
attcaggcggaatctgcaccctttaacttccctacacctaaaaccgtgcgtcgagctgag
tcagtagttcagattacgcttaactgcagcgatccaagtgtgttcttttctcagttggac
tttacatcgtcttctcttgggaaagataaaaacgatcattttgatttctatgttcgaggg
tttgagaacagttctcgtgggctcattgatttattgcttttgaatacagaagcgatttca
ttgtttgatgagcaaggcaatcaggttgagattgatacaaagcgtctagtatcgcgcgct
gctgatccttcatttaattggctgcccaatcatgggaatcaccagattggttttgatcta
gtgcgggagtatttcgcttaccctgataaagccgcctacattcggctggaaggtttgtat
aaagagttgtctcgattccaatcaagcacagtgacgttgaacttttttgtacaacaacta
ccggttgaatatttacgattgtttaatcgtcaggtgtttctattgaatacgacgccagcg
attaacctttatccgcagcgcggcgagccaatgcgatatgactttactaaattgtctatt
cctgttgtggctgatacgcaagctaacaacgaattgactgtggtatcggttgaaaaagtc
tgcgaagtgctgccaaccggagaagtggaacttagtccgatttacgagggcggttactgg
tttgacgacagtgcgccgaaatggcaagtacgtcagttttgggatgaaaaaggccgcaga
cttatggatctgtctgttagttatggctctgaggtaacagcccaagatgcggtggtttta
tccatgtcacttaaggtctgcaatggccgcttgccgtgtttagtccccagttactcacac
gctgagtcgtatgcagcggtggatattcccggagaactcaagaacgttcgtactccaacg
gcgcctcaatatcctgccttggataatcaattaagttggcgatttgttgccatgttgaat
gcgaatttttccagccttactcaggcagatgacgcgactagagccttacaagatgtgttg
cgtttgagcactcatagcattcagtgcaaagtggcggattcgataaaaaatgtgagctat
aaacacctcgttgctccaattacgattgaccggcagagcatatttgcctccggtacgcag
gtgacgattttgattgatgatgaactgttgggcgctgattttgcggtggtcagcaatgtg
ctcaacggtttctaccagcagtattgtagttttgatcggttcatgcaggttaatgtggag
cgcttcgggagtgatgttccgggaattgaattcgaaaaatgtcacgggagtcagctatgt
ctgtga

DBGET integrated database retrieval system