KEGG   Marinomonas mediterranea: Marme_0785Help
Entry
Marme_0785        CDS       T01449                                 

Definition
(GenBank) ImcF domain protein
  KO
K11891  type VI secretion system protein ImpL
Organism
mme  Marinomonas mediterranea
Pathway
mme03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:mme00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Marme_0785
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mme02044]
    Marme_0785
Secretion system [BR:mme02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Marme_0785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImcF-related_N IcmF-related IcmF_C DUF2244 Afaf MgtE
Motif
Other DBs
NCBI-ProteinID: ADZ90068
UniProt: F2K2M3
Position
846256..849660
Genome map
AA seq 1134 aa AA seqDB search
MTGKKKNIAMASSLGLVFSLIIAAIVWLFGVIFLTPLWVVAVEIATFIVVTVLLSWLVYL
YLRRPKVDEGEKQKKDWRDRIVSTRLAQVQKKHSRLSTNPYFVPWYVHLSPSIPEEQLWL
QQMGFESIESSEPVPDDLLALRFWVSDDAVLISLDLSYEQEVVVASLEALYKHVLKKRPR
QAFNGVICSVSLNSLINQSEIGVSDLSQRYRTILADLNTRTGLALPAYCLFTQMSSVRDF
CELFSTLDESEREKAFGSLHALSDGSGYEKTWFDSSFDDLLARLSVTLSESLKRQLNADY
RESSVSGVFQLSALRYDIEDFLSLTFSQHQFDDIELKFRGYFFINAGGETTSTDILTFMH
ASDLGFESLEGAHGKTTSLSLFSKSVFKHYIVKEASLVGVHKKKEWRYRTAKLCVSVGLL
SLFAGFVWLLKANYDYQSTIDNKALVMLERYKDNLKHDVIVRDDLSSPIFSLSELREINE
LYKTEQQPWYVSKWLPDSGIEKYVSKSYHFELNDVLLTLMRDYILKDMFVYNSLDDKVKT
LELLNLHQILYNPNRADVTALTHYYISELEEEGEGDADLVDRFKLLAQDVLNSGAVPPAA
DSELLTLVRSSLSSQDLSELLYQHILQHPEFARRIDVREQLNPSFTEVFTFKPGFTGYLV
PYLFTRRGFEDLYAETGFELATEAIQAYEGVMGRISGDAELNRINRQLRERYITDYIHYW
KDITSNVTWTSVSSWGDSQIQLELVTDAVFSPITQFYSLVNTHTNLASKGPEETDKEETQ
KSTDESDENANDASLNSTIARTAASISAPFLTLHKLVEPNKEGQTRLDIALNKLGQTQDW
VAKSKEITSRGRYFLEQLTNADSSNVLAQLEGVSDDYSDPILPFLLKGQARTINRLALNE
MRSVINDDWTVLSNYYQQRFSGRYPFDRSSIYDTSLADFEDYFKQGGMLDLFHNKYSVYF
EQVGSNSTLLKGFIPHQYASLSSRYSPFLETAKRFQSGLFIKDKVGFEFFIRAEQMSPNL
TRFGLESGARLFEYQNGPLFWQEQSWPIPSNQTQDIFIVTTDKKGSGTREKAVGEWSWFR
IASLMKGATMVGTDDVSWRYVFGDSYTNLRIKSKSGSQPFSPRFFEGATPPTVL
NT seq 3405 nt NT seq  +upstreamnt  +downstreamnt
atgacaggaaagaaaaaaaacatagcaatggcttcgagtttaggcctcgttttcagtctg
ataatcgcggctatagtttggctatttggggtgatttttctcacacctctttgggtggtc
gcggttgaaattgccacgtttattgtggttactgttctcttaagctggcttgtctacctt
tatttacgtcgtccgaaagtggatgaaggagaaaagcaaaaaaaagattggcgagataga
attgtaagtactcgactggctcaagttcaaaagaaacacagtcgcttgtcgaccaaccct
tatttcgttccctggtatgtacacctttctccgagcattcctgaagaacaattatggctt
cagcaaatgggctttgaaagtattgaatcgtctgagcctgttccagacgatctattagca
ttgcgcttctgggtttctgatgacgctgtattgatatcgcttgatctaagttatgaacag
gaagtggttgtcgccagcttagaagcgttgtacaagcacgttcttaaaaaacgtccgcgc
caagcgttcaacggcgttatctgttctgtcagcttgaacagtttaattaatcaaagtgaa
attggtgttagtgacttaagtcagcgctatcgaacgatattggcagaccttaatacccgc
accggattggctttgcctgcttattgcctctttactcaaatgtcgagcgttcgagacttt
tgtgagctgttctcaacgctggatgaaagtgaacgagaaaaagcgtttggctcattgcac
gccttgtcggatggtagcggttatgaaaaaacgtggtttgatagttcgtttgacgactta
ctggctcgcttatccgttacgctaagcgaatcgctaaagcgccaattaaatgccgactat
cgagagtcttcagtatcaggcgtatttcagttatcggcattgcggtatgacatagaagat
tttttatcactgacatttagccaacaccagtttgatgatattgaactaaagtttcgcggg
tattttttcattaatgcaggcggtgaaacgacatcgaccgacatccttacttttatgcac
gcttctgatctggggtttgaatctctagaaggagcacatggaaagacgacaagcttaagt
ctattcagcaaaagtgtgtttaagcattatattgtcaaagaagcctctttggtcggcgtg
cataagaaaaaagagtggcgttatcgcaccgcaaaactttgcgttagcgttgggttactt
tctttatttgctggtttcgtctggcttctaaaagccaattatgattatcaatcgaccatt
gataataaagcattggtcatgctagaacgctacaaagacaatctaaagcacgatgtgatt
gttagggatgacctttcttctccgatctttagtttgtcggagctgagggagatcaatgaa
ctgtataaaacggaacagcagccttggtatgtgtcgaaatggttacctgattcggggatc
gagaaatacgttagtaagtcctatcactttgagttgaatgacgtgctcttaacactgatg
agagactacatactgaaagatatgttcgtttataactcgcttgatgacaaagtaaaaacg
ctagagcttttaaatttacatcagattttatacaaccccaatcgcgcagatgttacggcg
ttaacccattactatatctctgaattggaggaagaaggagagggtgatgctgacctggta
gatcgctttaaattgcttgcgcaggatgttttaaactctggtgcagtgccgccagcagcg
gattctgaattgttaaccttggtgcgctcttcgttatcttcacaagaccttagtgagttg
ctgtatcaacatattttacagcacccagagtttgctcgccgaatcgacgttagagagcaa
ttgaatccatcgttcactgaggtgtttacattcaaacctggttttacaggttatctcgtc
ccgtatctgttcactcgacgtggctttgaagacttgtatgcagaaacaggctttgagtta
gcaacggaagcgatccaagcgtacgaaggtgtgatgggacgaatcagtggtgacgctgag
ctaaatcgaattaatcgtcagcttcgcgaacgttatatcacggactatatacactactgg
aaagacattacgtccaacgtaacatggaccagtgtctcatcttggggagacagccaaata
cagctcgagttggtcactgatgcggtgttttcaccgattactcaattttatagcttagtt
aacacgcatactaatttggcatcaaaaggtccagaagaaacagataaagaggaaactcaa
aaatcaacggatgagtccgacgaaaatgctaatgacgcttccttaaacagtacgattgcg
cgaacggctgcttcaatcagcgcgccatttctcacgctacataaactagtagaacccaat
aaagaggggcaaactcgtcttgatattgcgcttaacaaattaggacaaactcaggattgg
gtagctaagtcaaaagaaattacaagtcgtggtcggtatttcttagagcagttaaccaat
gctgattcgagtaatgtattggctcagttagaaggggtgtccgatgattacagcgacccc
attttacctttcttactcaaaggacaagctcgtactattaaccgcttggcgttaaatgaa
atgcgctcggtgattaatgatgattggacggttctttcgaactactatcagcagcgtttt
tccggtcgctacccttttgatcgttcatccatatatgatacatcattagctgactttgaa
gattactttaaacaaggtggcatgttagatctgtttcataacaaatacagcgtttatttt
gagcaggtcggttcgaatagcaccttgttaaagggctttattccccatcaatacgcatca
ttatcatcgcgatattcgccgtttttagagaccgctaaacgttttcagagtggtttgttt
atcaaggataaggtgggttttgagttctttattagagcggagcagatgtcgccgaattta
acgcgttttggtttggaatccggagcgcgtttattcgaatatcaaaatggtccgcttttt
tggcaagaacaaagttggccaatacccagcaaccaaacgcaagatatttttattgtcacg
actgataaaaaaggctcaggtactcgagaaaaggccgtaggagaatggagttggtttcgc
attgctagccttatgaaaggggcgacaatggtcggaacggatgatgtttcttggcgttac
gtttttggtgatagctataccaatcttaggatcaaatcgaagagtggtagtcagccgttt
tcacctcgattttttgagggagcgacgcctccaactgtcttatga

DBGET integrated database retrieval system