KEGG   Marinomonas mediterranea: Marme_1041Help
Entry
Marme_1041        CDS       T01449                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
mme  Marinomonas mediterranea
Pathway
mme00030  Pentose phosphate pathway
mme00480  Glutathione metabolism
mme01100  Metabolic pathways
mme01110  Biosynthesis of secondary metabolites
mme01120  Microbial metabolism in diverse environments
mme01130  Biosynthesis of antibiotics
mme01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Marme_1041
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Marme_1041
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mme04147]
    Marme_1041
Enzymes [BR:mme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     Marme_1041
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     Marme_1041
Exosome [BR:mme04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Marme_1041
  Exosomal proteins of colorectal cancer cells
   Marme_1041
  Exosomal proteins of bladder cancer cells
   Marme_1041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: ADZ90316
UniProt: F2JT98
Position
1166299..1167774
Genome map
AA seq 491 aa AA seqDB search
MKASLKACDVVIFGGGGDLAMRKLLPALYHLDMDGLLAPTTRIIGASRRDMSAKDYQDKV
RAALDEFVPASKEDTTIWSRFKERLSYVSVNAQEESDFARFNEHGVGDDERDAVFYLATS
PDLFGSICSSLAKFKLNQARMRVVLEKPLGRDLASSHAINNEVLQNFQESQIFRIDHYLG
KETVQNLLAIRFGNTLFEPLWSSAHIDNVQITVSETVGVEGRWGYYNKAGALRDMVQNHL
VQLLCLVAMEPPSRMDSTSVRDEKIKVLKALRPIEGANAYTKTVRGQYAKGMIDGKDVKG
FFDEEDSNPESRTETFVALRADVDNWRWAGVPFYLRTGKRLGQRYSEIVIQFKALPHSIF
NDESNRELQRNQLVIRLQPEEKISLTVMNKVPGASEGMNLQPVDLNLSLTEAFNDKRSPE
AYERLLLDVMRDDATLFMHYGEVEAAWKWVDGIMAAWAQTSERPKEYASGSWGPAASMAL
PIKDGRNWHDY
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccagtttaaaagcctgtgacgttgttatttttggcggcggtggtgatcttgca
atgcgcaagttattgccagctctgtaccatttagatatggatggattgctcgcaccgaca
actcgtattattggtgcgtcacgtcgtgatatgagtgccaaagattaccaagacaaagtt
cgtgctgctctggatgagttcgttcctgcaagcaaagaagacacaacgatttggagccga
tttaaagagcgtcttagttacgtatcggtgaatgctcaagaagaatctgattttgcacgt
tttaatgagcatggcgttggtgacgatgagcgagatgccgttttttacttggcgacgtct
ccggacctatttggctcaatctgttcttcattggctaaatttaaactgaatcaagccaga
atgcgtgttgtattagaaaaaccgcttggtcgtgacctcgcttcttcgcatgcaatcaac
aatgaagtattgcagaattttcaagagagccaaatcttccgaatcgaccactatctgggt
aaagaaacggttcaaaacctattagcaatccgttttggtaacactttgtttgagccgcta
tggtcaagtgctcatatcgacaacgttcaaatcaccgtatcggaaacggttggtgtagaa
ggccgatggggttattacaataaggctggtgcgttgcgtgacatggtacaaaaccatctg
gttcagctgctgtgtctggttgcaatggaaccgcctagccgtatggattcaacgtctgtc
cgagatgaaaagatcaaagttctgaaagcccttaggccaatagaaggggcaaatgcgtat
acaaaaacagttcgtggtcagtacgcaaaaggcatgatcgatggtaaagacgtaaagggc
ttctttgatgaagaagacagcaatccagaatcacgtaccgagacatttgtcgcgttacgt
gctgatgttgataactggcgttgggctggagtgccattttacttgcgaacgggcaagcgt
ttagggcagcgctactctgaaattgtgattcaatttaaagcgttaccgcatagtatcttt
aacgacgaaagtaatcgagaactgcaacgtaaccagcttgtgattcgtttacagccagaa
gaaaagatttcgcttactgttatgaataaagtgccgggtgcaagtgaagggatgaacctt
caacctgttgacctaaacttaagtttgacggaagcctttaacgataagcgcagtcctgaa
gcctacgagcgattgctactcgatgttatgcgtgacgatgcaaccttgtttatgcactac
ggcgaagtagaggcagcatggaaatgggtggacggtattatggctgcgtgggctcaaacg
agtgaacgccctaaagagtatgcgtctggttcatgggggccagcagcctcgatggcatta
ccaatcaaagacggccgtaattggcacgattactaa

DBGET integrated database retrieval system