KEGG   Marinomonas mediterranea: Marme_1387Help
Entry
Marme_1387        CDS       T01449                                 

Definition
(GenBank) Phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mme  Marinomonas mediterranea
Pathway
mme00010  Glycolysis / Gluconeogenesis
mme00260  Glycine, serine and threonine metabolism
mme00680  Methane metabolism
mme01100  Metabolic pathways
mme01110  Biosynthesis of secondary metabolites
mme01120  Microbial metabolism in diverse environments
mme01130  Biosynthesis of antibiotics
mme01200  Carbon metabolism
mme01230  Biosynthesis of amino acids
Module
mme_M00002  Glycolysis, core module involving three-carbon compounds
mme_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Marme_1387
  Energy metabolism
   00680 Methane metabolism
    Marme_1387
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Marme_1387
Enzymes [BR:mme01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Marme_1387
Membrane trafficking [BR:mme04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Marme_1387
Exosome [BR:mme04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Marme_1387
  Exosomal proteins of melanoma cells
   Marme_1387
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADZ90660
UniProt: F2JWI7
Position
1561386..1562105
Genome map
AA seq 239 aa AA seqDB search
MTRCALIRHGAYEQLKNVPSALQPFPLTEEGKNEVRRQACQFGDWLNASGMKLDPNVDSS
SLLRAWQTATIYMEELKDFFVSTPTLTGYPELCERSVGAVANLTIPEIERLLALDPRFEV
PAENWKSDSYYKLPFDGAESLIEAGERVANHILQWQSRVDHSENTSESKLNESELIKLFI
GHGASIRHAAFHINVINFCDIKQLSMYYGHPVVLEFANDQHPTKLFGDWKKRQIQEVPD
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgacacgctgcgcattgattcgacacggagcctacgagcagttgaaaaacgtgcctagc
gctctacagccatttcctctcactgaagaggggaagaacgaagttcgccgtcaggcatgc
cagtttggtgattggctcaacgcgtcaggcatgaagctggatccgaacgtcgattcatct
agcttattgcgagcttggcagacggccaccatttacatggaagagctaaaagatttcttt
gtttcgacaccgactctgacaggataccctgagttatgtgagcgcagtgttggcgctgtc
gcaaacctaacgattccagagatagaaaggctattggcgttagaccctcgatttgaagtc
cccgctgaaaactggaaatcggacagctattacaaactgccatttgatggcgctgagtcg
cttattgaggcgggcgagcgtgtcgcaaatcatatcttacaatggcaaagtcgcgtcgat
cacagtgaaaacactagtgaatctaaattaaacgaatctgaattaattaagttgtttatt
ggccacggagcgtccatacggcatgcagcatttcatataaatgtcataaacttttgcgat
attaagcagcttagtatgtactatgggcatcctgtggttttggaatttgccaatgatcag
catccgaccaaacttttcggggattggaaaaagcgtcagatccaagaagtaccagattga

DBGET integrated database retrieval system