KEGG   Marinomonas mediterranea: Marme_2042Help
Entry
Marme_2042        CDS       T01449                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mme  Marinomonas mediterranea
Pathway
mme00010  Glycolysis / Gluconeogenesis
mme00020  Citrate cycle (TCA cycle)
mme00620  Pyruvate metabolism
mme01100  Metabolic pathways
mme01110  Biosynthesis of secondary metabolites
mme01120  Microbial metabolism in diverse environments
mme01130  Biosynthesis of antibiotics
mme01200  Carbon metabolism
Module
mme_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Marme_2042
   00020 Citrate cycle (TCA cycle)
    Marme_2042
   00620 Pyruvate metabolism
    Marme_2042
Enzymes [BR:mme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Marme_2042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding GCV_H HlyD_D23 RnfC_N HlyD_3 PASTA
Motif
Other DBs
NCBI-ProteinID: ADZ91290
UniProt: F2K3E8
Position
2229999..2231951
Genome map
AA seq 650 aa AA seqDB search
MSTEIIRVPDIGGSTDVDVIEVSIQVGDMVEVDQSIIVLETDKASMDVPSPVAGKVVSIT
VKEGDSVSEGDEVLVLEVSGSVADTATPEAVAPVEAAPEVSKAIEQAPAAKAVSSEQPVS
VPDIGGATDVDVIEVCVAVGDSVAEGDSLIVLETDKASMDIPAPSAGKVVSVSINVGDTV
SEGDAILVLAVESVEDSVSSVVAVAPAPAVEAPAEVAVPTIIPGGVEQVVVPDIGSAEAV
DVIEVSVAAGDVVSEGDSLIVLETDKASMDIPAPKTGTVKSIVIKEGDKVSEGDLILDLE
VEAQVVAEAPKVVAPVAEKPVVTSEAPKAQATVPAQSAVLSTPSTKVHAGPAVRLLAREL
GVDLTLVRASGPRGRITKEDLHAYVKDAVKKAESGASKPSVVAEGAGIPRVPEIDFSQWG
DVDVVKMSKIQKITSYNMTRSWLNVPHVTQFDKADITDLEAFRKGLKAEMEKEGIKLTPL
PFLIKAVAQALVVNPSFNVSLHADGESIVKKKYVHIGIAVDSPVGLVVPVLRDADKKSIK
EIAVEANALIKKALAKQLKPADMQGGCFTISSLGAMGGTGFTPIVNTPEVGILGVSKADV
EPRWTGKEFEPRTMLPLCLSYDHRAVNGADAGRFMTFLNGLLSDLRRMTL
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
gtgagtactgaaattattcgagtaccggatattggcggttctactgatgttgatgtcatc
gaagtaagtattcaagttggtgatatggttgaggtagatcaatcaattattgttttagaa
actgacaaggcttctatggatgtgccgtctccagtagcaggaaaagtggtcagtattact
gtgaaagagggcgattccgtctccgagggtgacgaggttcttgttctagaggtttctggt
tctgttgcagatacagcgacgcctgaagcagtggcgcctgttgaagctgcgccagaagtt
tctaaagccattgagcaagctcctgcagcaaaggctgtaagctctgaacaacctgtttca
gttccagatattggtggtgctacggatgtagatgtcatcgaagtgtgtgtagcggttgga
gattccgtcgctgagggtgactctttaattgtattagaaaccgataaagcatcgatggac
atccctgcacctagtgccggtaaagtcgtaagtgtttccattaatgttggcgatacggtt
tccgagggtgacgctattttagtgcttgctgttgaatctgtagaggattcggtgagttct
gttgtggctgttgcacctgctccagcagtagaggcgccggctgaagttgcagtgccaacg
attattcctggtggtgttgagcaagttgttgttcctgatattggtagtgcggaagcggtt
gatgtcattgaagtaagtgtcgctgcgggagatgttgtatccgaaggtgactcactgatc
gttttggaaactgataaagcgtccatggacattcctgctcctaaaacaggcacggtgaaa
tctatcgtgatcaaagaaggtgataaggtatctgagggtgatttgatccttgatcttgag
gttgaagctcaagttgtggctgaggctccaaaggttgttgctccagttgctgagaagcct
gtagtcacttctgaggctccaaaggctcaagcgacggttcctgcgcagtctgccgttctt
tcaacgccttctacgaaggtgcatgcaggtccggcagttaggttgttagctcgagaattg
ggcgttgatttaacgcttgttcgtgcgtcaggtcctcgtggtcgaatcactaaagaagac
ttgcatgcgtacgtaaaagacgctgttaagaaagcggaatcaggtgcttctaaaccgtca
gttgttgcggaaggtgctggtatacctcgtgtgccagaaatcgactttagccaatgggga
gacgttgatgttgttaagatgagtaagatccaaaagatcacctcttacaatatgactcgt
tcttggttgaatgttccacatgttacgcaatttgataaagctgatatcactgacttagaa
gcgttccgtaaaggcttaaaagctgaaatggagaaagaggggattaaacttactccgctt
ccattcttgataaaagccgttgctcaagcgcttgttgtgaatccttcgtttaatgtgtcg
cttcatgctgatggtgaaagtatcgttaagaagaagtatgtgcatattggtattgcggtt
gattcaccggttggactggttgttcctgtgttgcgagacgcagacaagaagtcgatcaaa
gagattgcagtagaagcgaatgctttgattaagaaagcgcttgctaagcagcttaaacct
gccgatatgcagggtggctgcttcactatctctagtcttggtgctatgggtggtacgggc
ttcactccaatcgtcaatacaccagaagtgggtattctaggtgtttctaaagcagatgta
gaaccacgttggacgggtaaagagtttgaacctcgtactatgttgccgttgtgtctgtca
tatgatcaccgagcggtgaacggtgctgatgcgggtcgctttatgacattcctaaatgga
ttgttgagtgatttacgtcgcatgacgctttaa

DBGET integrated database retrieval system