KEGG   Marinomonas mediterranea: Marme_2465Help
Entry
Marme_2465        CDS       T01449                                 

Definition
(GenBank) Betaine-aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mme  Marinomonas mediterranea
Pathway
mme00010  Glycolysis / Gluconeogenesis
mme00053  Ascorbate and aldarate metabolism
mme00071  Fatty acid degradation
mme00280  Valine, leucine and isoleucine degradation
mme00310  Lysine degradation
mme00330  Arginine and proline metabolism
mme00340  Histidine metabolism
mme00380  Tryptophan metabolism
mme00410  beta-Alanine metabolism
mme00561  Glycerolipid metabolism
mme00620  Pyruvate metabolism
mme00625  Chloroalkane and chloroalkene degradation
mme00903  Limonene and pinene degradation
mme01100  Metabolic pathways
mme01110  Biosynthesis of secondary metabolites
mme01120  Microbial metabolism in diverse environments
mme01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Marme_2465
   00053 Ascorbate and aldarate metabolism
    Marme_2465
   00620 Pyruvate metabolism
    Marme_2465
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Marme_2465
   00561 Glycerolipid metabolism
    Marme_2465
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Marme_2465
   00310 Lysine degradation
    Marme_2465
   00330 Arginine and proline metabolism
    Marme_2465
   00340 Histidine metabolism
    Marme_2465
   00380 Tryptophan metabolism
    Marme_2465
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Marme_2465
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Marme_2465
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Marme_2465
Enzymes [BR:mme01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Marme_2465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: ADZ91697
UniProt: F2JVR1
Position
complement(2711020..2712492)
Genome map
AA seq 490 aa AA seqDB search
MLSFNPSEVRIPNSHFIGGIAVDGGTGIDVKRPSDNQSYASVPNATPDLVDQAVENAYRA
FKESGWADLSPRDRAKAMKRWANLIENDVNTLAQLESVGSTRPISAAVNWDVPFCAEGIR
FYAEYADKCGGEVIPTQSDHLGMTITEPLGVVGAIAPWNFPLVMASWKVAPAIAAGNAVV
LKPSEMTPFSVVRLAELAVEAGIPPGIFNVIQGDGLVGDTLARHPMISKVTFTGSTHTGA
LVMTACAQSGTKPVTLELGGKSPQLVFDDIKDIDKVARRIAGAITTNSGQVCVAGSRLLV
QSGVAEQLIELISSVFEEQIAQSTWQDQATLSPIISAKEVDRIDSVVRKTVEEGANLYTG
GCPLETADFSAFYKPTILTDVDMSMGAVRNEIFGPVLCVETFETDDDALSLASHPSYGLS
AGVHTADLNRAMRMVKSLDAGTVWVNRYGRSWDFAIPTGGFKSSGIGKDLGRQAYEANRR
VKSVLIDFSE
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcgtttaatccttcagaggttcgaattccaaacagtcattttattggtggtatt
gccgttgatggcggtacgggaatcgatgttaaacgtccttcggacaatcagtcgtacgca
tccgtaccgaatgcgacaccagatttggtagatcaagcggtggaaaatgcttatagagcc
tttaaggaaagtggttgggccgatctttcgccacgcgacagagcaaaagcgatgaagcgt
tgggcaaatttgattgaaaatgatgtgaataccttagctcaacttgagtctgttgggtcg
acacgtccaatcagtgctgcggttaattgggatgtgcctttttgtgcagaaggcatccgg
ttctatgctgaatatgccgataaatgtggcggtgaagtgatcccaacacaatcagatcat
cttggtatgacgattacggaacctttaggtgttgttggggccattgcgccgtggaatttc
ccacttgttatggcgtcttggaaagtggcaccagcgatcgcagcaggaaatgctgttgtt
ttaaaaccttccgaaatgacgccgtttagcgtcgtgagattagcagagttagcagtagaa
gctggcataccgccaggtatttttaacgtcattcaaggtgatggtttggtcggggataca
ctggcaagacaccctatgatttctaaagtgacgtttactggatcaacacataccggcgcg
cttgttatgaccgcgtgtgctcagtcaggtaccaaacctgtcacactggagctgggtggt
aagagtcctcaactggtgtttgatgacattaaagatatcgataaagttgcccgtcgtatt
gcaggggcgatcacaacgaactcgggtcaggtttgtgtggcgggatctcgtctgctggtt
caaagcggtgttgcagagcagcttattgagcttatctcttcggtattcgaagagcaaatt
gcacaatcaacatggcaagaccaagcgacactttctcctattatttctgctaaagaagtc
gacagaatcgacagtgtcgtccgcaaaacagtcgaggagggcgcaaacctttatacaggt
ggttgtcctttggaaaccgctgatttctctgctttctacaagccgactattttgaccgat
gtcgatatgagtatgggtgcggtaagaaacgaaatattcggtccggttttgtgtgttgag
acatttgaaacggacgatgacgcattgtcattggcatctcatccttcctacggtttgtct
gcgggcgttcatacagcagatctaaatcgcgcgatgcgaatggttaaatcattggatgca
ggtacggtttgggtaaaccgatatgggcgtagttgggatttcgcgatcccaacaggcgga
tttaagagctcaggtattggtaaagatttagggcgtcaagcgtatgaggcgaatcgtcga
gttaaaagtgtcttgatcgatttctctgaatag

DBGET integrated database retrieval system