KEGG   Marinomonas mediterranea: Marme_3128Help
Entry
Marme_3128        CDS       T01449                                 

Definition
(GenBank) 1,4-alpha-glucan-branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mme  Marinomonas mediterranea
Pathway
mme00500  Starch and sucrose metabolism
mme01100  Metabolic pathways
mme01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mme00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Marme_3128
Enzymes [BR:mme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Marme_3128
Exosome [BR:mme04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Marme_3128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase Glyco_hydro_70 Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: ADZ92346
UniProt: F2K2V7
Position
3440887..3443055
Genome map
AA seq 722 aa AA seqDB search
MDLFEDIVNARCSDPFGFLGLHWTEEKDLKLNVWRPDAVAIDVLAIDADSVIGKMNLNTD
SGLFSCQWSDKKTFFHYRLRITFSDGNTATFVDPYQFNQATFADPEHHKATLYQKEGALF
QSAPVTDSLAIDGTRFAVYAPAARSVYVVGDFNGWDGRIHPMSSNGDGVWRLFIPDVRDG
AKYKFEIRAKSGDLLPHRTDPFAKRIEQFPSFASVVQESQYHWNDESWMSRPISDIYEEA
VSIYEVHLGSWRKKEHNESLTYLELKEQLVPYVVEMGYTHVELLPVMEYPFDGSWGYQPV
GLFAVTSRYGTPDEFKALIDAFHQAGISVIMDWVPAHFPSDSHGLANFDGTHQYEYEDPK
KGWHPEWNSLIYDFGKEHVVDFLISNANFWLEEYHIDGLRVDAVASMLYLDYSREDGEWI
PNVHGGNHNYEAIAFLKQLNETVYLNHPRCFTVAEESTAFSGVSKPTYMDGLGFGFKWNM
GWMNDTLEYMKKDPIHRQYHQGELTFSMVYAFNEQFMLPISHDEVVHGKGSMIDKMPGDG
WQKFANLRAFNGYMFTHPGKKLNFMGNEFAQGQEWSHTRSLDWHLLDIDYHKGLQTLVKD
LNHLYTGEPALQLDHDYQGFEWLSYDDSQNSILAYVRQSKAKDELLIVVVNFTPTPHKGY
RIGAPKLGRYDLILNTDASIYGGSGFHTAQTLEAESIENHGRNDSVMLDIPPLSTVIYKW
KS
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atggatctgtttgaagacattgtaaatgcccgctgttccgaccctttcggattccttggc
ctacactggactgaagaaaaagacttgaaacttaacgtttggcgacctgatgccgtcgcg
atcgatgtacttgcaatcgacgcagactcagtcattgggaaaatgaatttaaacactgac
agcggactgttctcttgtcagtggtcggataaaaaaacgtttttccactaccgtctcaga
atcacattctcagacggcaatactgcaaccttcgtcgatccttatcagtttaatcaagca
acgtttgctgatcctgagcatcacaaagcaaccctttaccaaaaagaaggcgctctgttt
caaagtgcgccagtaacggattctctagcgatcgatggaactcgatttgctgtctatgcc
cccgcagctcgttcagtatacgtcgtgggcgactttaacggctgggacggccgtatccat
ccgatgtcgagcaatggcgacggagtatggcgactcttcattcctgatgtccgagatggc
gcgaaatataagtttgaaatcagagcaaaatcaggcgacctactgccacatagaaccgat
ccctttgcaaaacgaatcgagcaatttccttcatttgccagtgtcgtacaggaatcccag
taccactggaatgatgaaagctggatgtcgcgacctatatcagatatttacgaagaagcg
gtcagtatatatgaggtacatctcggctcttggagaaagaaagagcacaacgagtcgctt
acttatctagagttgaaagagcaacttgtaccgtatgttgtcgaaatgggttatacgcac
gtagaactgctacctgttatggagtacccgtttgatgggtcttggggttatcaacctgtt
ggcttattcgcggtaacgtctcgatacggcacaccagacgaattcaaagcgttaatcgat
gcattccatcaagctggaatcagtgtcattatggattgggttccagcgcatttcccatcc
gatagccatgggctcgcgaactttgatggaacccatcagtacgagtacgaagacccgaaa
aaaggctggcaccccgaatggaactctttgatctacgattttggtaaagaacacgtcgtt
gacttcctaatcagcaacgcaaatttctggttagaggaataccatattgacggcctgcga
gtcgatgcggttgcatccatgttgtatctggattactcacgcgaagacggcgaatggatt
ccaaatgttcatggcggcaatcacaactacgaagcgattgcgttcttgaaacaactgaat
gagacggtttacttgaaccacccacgttgtttcacagttgcagaagagtctaccgccttt
tcaggcgtgtctaaaccgacctatatggacggcctagggttcgggttcaagtggaatatg
ggctggatgaacgataccttagagtatatgaagaaagacccgattcaccgtcaataccat
cagggtgagctcaccttctccatggtatacgcctttaatgagcagtttatgctgcctatt
tcacatgacgaagtggttcatggaaaaggctctatgatcgacaaaatgcccggcgatggc
tggcagaagtttgcaaaccttagggcgttcaatggctacatgtttactcaccccggtaag
aaactaaactttatggggaacgaatttgctcaaggtcaagaatggagccacactagatcc
ctagactggcacttgctcgatatcgattaccacaaagggctacaaacactggtcaaagac
ttaaatcacctctataccggtgagcctgcgctgcaactagatcacgattatcaaggattt
gaatggctttcttatgatgacagtcaaaactccattcttgcttacgtaaggcaatctaag
gcaaaagatgaattactgatcgttgttgtgaattttacaccaacacctcacaaaggttac
cggataggtgcgccaaaattagggcgctatgacctgattttaaatactgatgcctctatc
tatggtggaagtgggttccacacggcacaaacgcttgaggctgaaagcattgaaaaccac
ggtagaaacgacagtgtcatgctcgatattccaccactttcaactgtaatctataaatgg
aaatcttag

DBGET integrated database retrieval system