KEGG   Marinomonas mediterranea: Marme_3666
Entry
Marme_3666        CDS       T01449                                 

Definition
(GenBank) type VI secretion protein, VC_A0111 family
  KO
K11895  type VI secretion system protein ImpH
Organism
mme  Marinomonas mediterranea
Brite
KEGG Orthology (KO) [BR:mme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mme02044]
    Marme_3666
Secretion system [BR:mme02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Marme_3666
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: ADZ92878
UniProt: F2JVZ0
Position
complement(4048614..4049603)
AA seq 329 aa
MHRELDTHSLKASACEYHYHQLLNVLLKMKDQTQVRDKPSWLTLKPSDWLSFPASDVHKL
TQGHNDNWQLEATFFGLYGVDAPTPHYFLQDVTQNSEAGKCIAAFLDIFNQNAYWLLHKS
WQKFQPLANAGNDNLFIKMCLAISGRLPLPRSEYNKGSDGDAPSTVGQKGFSVGALSNRK
KSLCVVENMLRHALSLPNLMVSSNLVKTVDTHQALPLGELLSLGDNTLLGSKVSVVGQAI
KINLGVISLEHLEDFKPGGEKARYLASLLEDYLPTLVSYRIGASVVVEGMPPMELSTKGQ
ALKLGAPLVLGEAGQNIEYEFSDQSYQNF
NT seq 990 nt   +upstreamnt  +downstreamnt
atgcacagagagttagatactcattcccttaaagcgtccgcctgtgagtaccactatcat
cagttgctaaacgtactgctaaagatgaaggatcaaacgcaagtcagggacaaaccttct
tggcttacgttgaaaccatctgactggttatcctttcctgcctctgatgttcataagtta
actcaaggtcataatgacaattggcagttagaggcgactttttttggtctttatggggtg
gatgctccgacaccccattactttcttcaagatgtgacgcagaactcagaagccggaaag
tgtattgcggctttcttagatatttttaatcaaaatgcctattggttgttgcacaagagc
tggcaaaaattccagcctctcgcgaatgcaggaaacgataacctctttattaaaatgtgc
ttggcaatatccggtcgattgcctcttccacgcagtgaatataacaaaggcagtgatggc
gatgcgccttcaacagtagggcaaaaaggtttttcggttggggcgctttctaaccggaaa
aaaagcctatgtgttgtcgagaatatgcttaggcacgctttgtctctacctaatttaatg
gtttcttctaatttagtgaaaaccgtcgatacgcatcaagcgttgcctttaggggagttg
ttatcgttaggtgacaataccttacttggaagcaaagtctcggtcgttgggcaggctata
aagatcaacctaggtgtgattagtttagaacacttggaagactttaagcctgggggagag
aaggcgcgctatttggcgtctttattggaagattacttgccgactctcgtttcataccgg
ataggggcgagtgtggtggttgaaggaatgccgccaatggaactaagcaccaaagggcaa
gcgcttaaactaggcgcgccattggtgttaggggaagcggggcaaaatatagagtatgag
ttcagcgatcaaagttaccagaatttttaa

DBGET integrated database retrieval system