KEGG   Marinomonas mediterranea: Marme_3670Help
Entry
Marme_3670        CDS       T01449                                 

Definition
(GenBank) type VI secretion protein, EvpB/VC_A0108 family
  KO
K11900  type VI secretion system protein ImpC
Organism
mme  Marinomonas mediterranea
Brite
KEGG Orthology (KO) [BR:mme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mme02044]
    Marme_3670
Secretion system [BR:mme02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Marme_3670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VipB
Motif
Other DBs
NCBI-ProteinID: ADZ92882
UniProt: F2JVZ4
Position
complement(4052513..4054036)
Genome map
AA seq 507 aa AA seqDB search
MSVQESVSTSAASVEFAEDSVYQRLCGLIQMEPVDAPVDINKFQNPKHMAEVETNERITA
ALKVFFELALESGTQIERIDKTLLDQYIATIDDVISAQLDEVLHHKDFQKVESSWRGLKF
LVDRTDFKANMKIELLDCTKEALREDFEESPDTTQSGLFDQIYTQEYDTPGGEPVTSMIA
NFEFDRTGADVELLTEVSKVASAAHCPFISAIGPEFFDKESIEDIPKIQDIGTYMDRAEY
IRWKGFRETEDSRYVGLVFPRFLLRLPYGEENPIRSFNYREGVTGEQHNRYLWGNSAFAF
AANMTRSFKKNGWTVNIRGPESGGKLDKLPIHFYQSGRGTESKIPTEVLISETKELELAD
HGFIPLSYYKNSDYACFFSANSTQRPLECDEDADTANARINSRLPYIFLVSRIAQYLKIL
QRENIGSLKSRQDLENELNAWLQSLVTKMNNPEPELAATHPLKDGRVFVSESEDNPGYYF
VNMHVQPHFQVEGVDVKLSLVSQMPEV
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtacaagaaagtgtatctacaagcgctgcgagtgttgagtttgcagaagattct
gtctatcaacgattgtgcggcttgattcaaatggaacctgttgacgcgccagttgatatc
aacaaatttcaaaacccgaaacatatggctgaagtggagacaaacgagcgaatcactgcg
gcgttgaaggtgttttttgaacttgcgctagagtctggcacacagatagagagaattgat
aaaacacttcttgatcaatatatcgcaacgattgatgacgttattagtgcacaacttgat
gaagtcttgcatcacaaagacttccagaaagtggaatcgtcatggcgtggtcttaagttt
ttagtcgaccgtactgactttaaagccaatatgaaaattgagctactggactgtacgaaa
gaggcgctacgagaagattttgaagagtctccagacacgactcagtcaggattgtttgat
cagatttacacacaggaatacgacacaccgggtggcgaacctgtgacatctatgattgcc
aacttcgaattcgaccgtactggtgcggatgtggagttgctaacagaagtatcgaaagtg
gcgagtgccgcccactgtccgtttatcagcgcaattggcccagaattctttgacaaagaa
agcatagaagatattccaaaaattcaagatatcggcacgtacatggatcgcgctgagtac
attcgttggaaaggtttccgagaaacggaagattctcgttacgttggtcttgttttccct
cgttttcttttacgcttaccttatggtgaagagaaccctattcgctcatttaactaccgt
gagggcgtgacgggtgaacaacacaatcgttatttgtggggtaactctgcttttgctttc
gccgcgaatatgacgcgcagctttaagaaaaatggttggacagtcaatatacgtggtcca
gagtcaggcggtaaactggataaactaccaatccacttctatcaatcggggcgtggaaca
gaatctaaaattccaacggaagttctgatttcagagacgaaagagctggaactagcagac
catggttttattccactgagttactacaaaaacagtgactatgcttgtttcttctctgcg
aactccactcaacgcccattagagtgcgatgaggatgcagacacagcgaacgcaagaatc
aactcaagattaccttatattttcttggtgtctcgtatcgctcaatacctgaaaattttg
caacgtgaaaacattggttcattaaagtcgcgtcaagatttagagaacgaattgaatgcg
tggttgcagagtcttgtgactaaaatgaacaaccctgaaccagaactagcggcgacacac
cctctaaaagatggacgtgtgtttgttagcgagtccgaagacaacccaggctattacttt
gtgaacatgcacgtgcaaccgcactttcaagttgaaggtgttgatgtgaagctttcgctt
gtgtctcaaatgccagaagtttaa

DBGET integrated database retrieval system