KEGG   Marinomonas mediterranea: Marme_3674
Entry
Marme_3674        CDS       T01449                                 

Definition
(GenBank) type VI secretion protein IcmF
  KO
K11891  type VI secretion system protein ImpL
Organism
mme  Marinomonas mediterranea
Pathway
mme03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:mme00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Marme_3674
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mme02044]
    Marme_3674
Secretion system [BR:mme02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Marme_3674
SSDB
Motif
Pfam: IcmF-related_N IcmF-related IcmF_C ABC_tran AAA_29 MMR_HSR1
Other DBs
NCBI-ProteinID: ADZ92886
UniProt: F2JVZ8
Position
complement(4057228..4060980)
AA seq 1250 aa
MFKNSIGKLLKGLLLSRLFGMSVGIGAILLLIWVLGGKIGLTSEKLKLQVMAAILACFLL
GCLIRKLVFFLRTKKLKSQLDNAGGSESSGLFQDKISDVLKALKSSQLGAQYRGDKALYA
LPWYMVIGPSGAGKSTLFARSGLDFPLKDDQRFHFQGIGGTRDCDWWFSDKAILIDTAGR
YTQDENNDEWINFLRVLKSSRSKAPINGLILALPLDEILTTEREALEAHVKYLKNRLHEL
ISELGVTFPIYIVVTKADKLKGFEAFFDDLSPNETKNPWGIYTLEETENKNVNIAEVVET
RLNELYERLLEQTIQKVNLATDTTNKVEAFQFPNQFSGAVDKLNELLRLLFKDNPYHESP
WFAGVYFTSGTQEGDTLERSSNALKSVFAKVGRRFSKTKNNEQSYFIDRLFSDVIFPLKD
AVRGNRKRQRIGRLAKTATVLSTLTILIFSGIGLFTTYTANQLLISDYEEKVKTLMLRVN
DSRSSELDRLNAIVGMYQQYQKLDNIQTYSPLQLVHQYSFVESHGEAIKRLLENTIADTI
HQKAVPTLLSSLDEYVTAWPELDAAKRKEIQDDYYVSLKTYLMLTSNQDKFDMAFVSQAI
GNLWYRSYEEAEVRLNFKERQALFSDMANLYLSESMSEAGEVRFIGHRDNVSNHESPGYK
NPWLLLEPSDGSKDIVATAQAQLTTKADPEALYRRLIAEAKNRFEAVALSDVLSQSGLSV
MYSDASVDGIFTQKAWFDYVSERIDEVSDIASKGDWVLGISEADSNDVDESVLLTLRKDI
RKRYFHQYTQEWSRFLSSVKVSSFKNLAEATQGLKALGIDHSPWKVLFDRVATEITLVEP
EYKVQLLAQFAKDETPEEAPTGLLDNAGNALDQLPIDIPLIPNFEIAATDLLALVQPVKG
ASANVNLSLYQNAMRALSEEFEYILASADINLEAKSYARSLITGDTAGKRQLYSTWIEVN
NILLEMSPRESKALSKPFKAPLSYAWRTILASTRTAIQQDWERRVYGSYLEKVHGRFPFK
DNVVDAAPLDVQGLLLPESGDFWMFFKDEIEPFLRYSNNKWRNRTWLKQGLGVNRQFIES
LAGAGRISQALFKQGTAEMKMSYAVYPIPVPGVTESLFEVNGEGYRYRNEPQEWREFVWR
PVDNQGGAKVRVKTAYEANPELLEESGQWALLRLLKKAIVHHIRGTEFELEWPMNDVSSA
ELNADFEGDTTANASGTSVKYRIRADREGSVLNTSIIGDFELPKRLFGAR
NT seq 3753 nt   +upstreamnt  +downstreamnt
atgtttaaaaattccattggcaagctgctaaagggcttgctgctatctcgcttgtttggc
atgtcggttggtattggcgcgatactgcttttgatttgggtactaggaggcaaaattggc
cttactagcgaaaaactaaagcttcaagtgatggctgctattctagcgtgctttctactt
ggttgccttattcgcaaactcgtattctttttacgtactaaaaagcttaagagccaatta
gataatgccggtgggagtgagagctctggcctgtttcaggacaaaatttctgatgtgtta
aaggcgcttaagtcatcgcaattgggcgcgcagtaccgaggtgataaggccttgtatgcg
cttccttggtacatggtgattggcccatctggcgcaggaaaaagtaccttatttgcccgt
tcgggcctcgattttccgttgaaagacgatcagcgtttccactttcagggtattggtgga
acacgtgattgtgattggtggttttctgataaagcgatccttattgatacagcaggtcgc
tacacacaagatgaaaacaacgacgaatggattaacttcttaagagtgttaaaaagcagc
cgttccaaagcgccaatcaacggtttgattttggctttaccgcttgatgaaattttgacg
acagagcgtgaagcgctagaagcgcatgtgaagtatcttaaaaatcgtctgcatgagctg
atttcagaattaggtgtgacgttccctatttatattgttgttacgaaagccgataagctg
aaaggctttgaggcattttttgatgacctaagtcctaacgaaactaaaaatccgtggggg
atatacacgctagaggaaactgaaaataagaacgttaatatcgcggaggttgtcgaaacg
cgtttgaatgagctgtatgagcggttgctagaacaaacgatacaaaaagtgaatttggcg
actgacacgactaataaggtagaagcttttcagtttccaaaccagttctcaggtgccgta
gataagctaaacgaactgttaaggttgttgtttaaagacaacccatatcacgaatcaccg
tggtttgcgggcgtctattttacatctggcacgcaggaaggtgacacattagaacgcagc
tccaatgcgctaaaaagtgtctttgcgaaagtgggccgacgcttttcaaaaaccaaaaat
aatgaacagagctatttcattgataggttgttttcagacgtgattttcccgttaaaagat
gcggttcgtggtaaccgtaaacgtcaaaggataggacgtctagccaaaacggcgacagta
ctttcaacgcttacaattttgattttttcaggtattggcttattcacaacgtacaccgcc
aatcagttgcttatctcagattatgaagagaaagtgaaaaccttgatgcttcgtgtcaac
gatagtcgttcctctgaattggatcgattgaatgcgatagtcggaatgtaccagcagtat
caaaagcttgataatattcaaacgtactcgccacttcaactcgtgcatcaatatagtttt
gttgagtcccacggcgaagccattaaaaggttactagagaacacgatagccgatacgatt
catcaaaaagcggttcctacattattgtcgtcattagatgaatacgtcactgcttggcct
gaattggatgcggctaagcgtaaagagatccaagatgactactatgtgtcgttaaaaacg
tatcttatgttgacgagcaatcaagataagtttgacatggcgtttgttagtcaagcgatt
ggtaatctatggtatcgctcgtatgaggaagccgaagtacgtttgaattttaaagaacgt
caggcgttattctcagacatggctaacttatacctaagcgaaagcatgtctgaagcagga
gaggtccgttttattggccaccgcgataacgtttctaaccatgaatcgccaggctataag
aacccatggctattactagaaccttctgatggttcaaaagatattgtggcgacagctcag
gcgcagttaaccacgaaagcagatcccgaagctctatatcgccgcttgattgcagaagcg
aaaaatcgctttgaagcagtcgcattatcggatgtcttgagtcaatccgggctttcagtg
atgtactctgatgcgtcagtcgatggtattttcacacagaaagcgtggttcgattatgtc
tctgaaaggattgatgaagtttcagacattgcgagtaagggtgattgggtattagggatt
tcagaagcagactctaacgacgttgatgaatccgttttattgacacttcgtaaagatatt
cgtaaacgttactttcatcaatatacgcaggaatggtcgcgtttcttaagttctgtcaaa
gtgtcttcgttcaaaaacttagcggaagcgacacaaggccttaaagcactgggtattgat
cattcgccttggaaagttcttttcgatcgtgttgcgacagagattacacttgttgagcca
gagtataaggtgcaacttttagctcaatttgcaaaagatgaaacgccagaagaggcgccg
acaggcctgctcgataacgctggaaatgcgttggatcaattgccaatcgacatacctttg
attcctaattttgaaattgcagcaactgacttgttagcacttgtacaacccgtaaaaggc
gcgtctgcaaacgtaaacctatcgttatatcaaaatgcgatgcgagcgctgagtgaggaa
tttgaatatatcttagcgtctgctgacatcaacctagaagcgaagtcttatgcgcgatct
ttgataacgggtgatacggcaggcaagcgtcagctgtacagtacatggatcgaagtgaat
aacattttattagagatgtctcctcgggaaagtaaagcgcttagcaaacctttcaaggcg
ccacttagctatgcttggcgaacgattctggcaagcaccagaacggctattcagcaagat
tgggaaagacgtgtctacggttcttatttagagaaagtgcatggtcgttttcctttcaaa
gacaatgtcgttgacgctgcaccacttgatgttcagggattgctactaccggaatcgggt
gatttttggatgttctttaaagatgaaattgagccatttcttcgctactcaaacaacaaa
tggcgtaaccgcacttggttaaagcaaggtcttggggttaaccgccaatttattgagtct
ttagcgggggcgggccgtatttcacaggcgttgtttaaacaaggcacagcggagatgaaa
atgtcctatgcggtatatccgatccccgttccaggggtgactgaatctctctttgaagtg
aatggtgaaggttatcgataccgcaacgagccacaggaatggcgcgaatttgtatggcga
cctgtcgataatcaaggtggtgcgaaggttagggtgaaaacggcgtatgaggccaatcca
gagctacttgaagagtcagggcagtgggcgttacttcgactattgaaaaaggccatagtt
catcatattcgcggaacggaattcgaattagagtggcccatgaacgacgtttcgagcgca
gagctaaacgctgactttgaaggtgacaccacggcgaatgcttctggaacatcggtaaaa
tatcgtatcagagcggaccgtgaaggaagtgttctaaataccagtattatcggcgacttt
gaacttcctaaacgcttatttggggcgcgctaa

DBGET integrated database retrieval system