KEGG   Martelella mediterranea: Mame_00565Help
Entry
Mame_00565        CDS       T04757                                 

Definition
(GenBank) putative epimerase/dehydratase
  KO
K18981  uronate dehydrogenase [EC:1.1.1.203]
Organism
mmed  Martelella mediterranea
Pathway
mmed00053  Ascorbate and aldarate metabolism
mmed01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmed00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    Mame_00565
Enzymes [BR:mmed01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.203  uronate dehydrogenase
     Mame_00565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3Beta_HSD Epimerase GDP_Man_Dehyd Polysacc_synt_2 RmlD_sub_bind NAD_binding_10 NAD_binding_4 KR adh_short Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: AQZ49948
UniProt: A0A1U9YWY5
Position
619907..620785
Genome map
AA seq 292 aa AA seqDB search
MPHRESEAAREAGAEPVKPVSAQTVVITGGAGKIGRASRKHLAGMLKAIRVVDIVEPDDL
AENESWHRVDICDPEAVRQALDGADSVVHLAGYPNERSIDEIFRVNVMGTHNIYEAARQT
GVNRIVFGSSNHTVGFYPRSARISPQDAMRPDTFYGLGKCWSELQAGLYFERYGIQTLSI
RIGNATAGIFDERSRVTWLGYRDFAELVRIGLEHPDIDCTTVFGVSKSDQTWWDNSNAQA
LGYCPQQDAETDAAPGPSRLAVTAFPEINDYFQGGRYCVIDHDGQVRRRRWP
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgccccatagagaaagcgaggccgcccgagaggccggtgccgagccggtgaagcctgtc
agcgcgcagaccgtggtgataacaggcggcgccggaaagatcggccgcgccagccgcaag
catcttgccggaatgcttaaagcaatccgcgtcgtcgatatcgtcgagccggacgacctt
gcggaaaacgaaagctggcatcgggtcgatatctgcgatccggaagcggttcggcaggct
ctggacggggccgatagcgtcgtccatctcgccggctatcccaatgagcggtcgatcgac
gagatattccgcgtcaacgtgatgggcacccacaacatctacgaagcggcgcggcagacc
ggcgtcaatcgcatcgtcttcggttcgtccaaccacaccgttggcttttatccacgctcc
gccaggatctccccgcaggacgccatgcgaccagacaccttctacggccttggcaaatgc
tggagcgagcttcaggccggcctctatttcgagcgctatggcatccagaccctcagcatc
cggatcggcaacgccactgccggcattttcgacgagcgctcgcgggtgacctggcttgga
tatcgcgatttcgcggaactcgtccgcatcggtctcgaacaccccgatatcgattgcacg
acggtgttcggagtctcgaagagcgatcagacatggtgggacaattcaaatgcgcaggcc
ctgggctattgcccgcagcaggatgcggagacagacgctgcaccggggccaagccgactg
gcggtaaccgcatttccggagatcaacgactacttccagggcggacgttactgcgtgatc
gaccatgacggccaggttcgccgacgtcgctggccctga

DBGET integrated database retrieval system