KEGG   Martelella mediterranea: Mame_00810Help
Entry
Mame_00810        CDS       T04757                                 

Gene name
aldH_3
Definition
(GenBank) NADP-dependent fatty aldehyde dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
mmed  Martelella mediterranea
Pathway
mmed00040  Pentose and glucuronate interconversions
mmed00053  Ascorbate and aldarate metabolism
mmed01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmed00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mame_00810 (aldH_3)
   00053 Ascorbate and aldarate metabolism
    Mame_00810 (aldH_3)
Enzymes [BR:mmed01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     Mame_00810 (aldH_3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AQZ50186
UniProt: A0A1U9YXN0
Position
complement(892351..893871)
Genome map
AA seq 506 aa AA seqDB search
MTFEPHGRHLIGGEWKETAKRFSSQPVTGKRLEYFEADEALVDEAVKAAEAAFWDYGYTS
RRTRAEFLNKIADEIEKRGSDITAIAMAETGLPEARLEGERGRTTGQLRMFARHILDGDY
LDRRHDAANPEATPPSPDLKMIQRPIGPVAVFGASNFPLAFSTAGGDTASALAAGCPVVV
KGHPAHPGTGEIVAEAIAAAAEKCGIHPGVFSLLQGASHEAGTMLVTHPLIKAVGFTGSL
AGGKALFDLCARRDEPIPFFGELGSVNPNFLLPDALANRGSEIAKGWAGSLTMGVGQFCT
NPGLMVTLAGPEADRFAEEAAEELGRVGAATMLTDGIAEAFRKGSDAVAHASGVETLVKL
EADGRKAAPALYKVSAAAFIENPALAHEVFGPLGIIVVASNAQEMRAVAERLEGQLTCTL
HMDHDDAEFAGSLLPVLERKAGRLLANGFSTGVAVADAMIHGGPYPATTNFGGTSVGTMA
IRRFLRPVCYQNMPAALLPEDLRHTG
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgactttcgaaccacatggccggcacctgatcggcggcgaatggaaagaaaccgccaaa
cgcttcagctcacagccagtgaccggaaagcggctcgaatatttcgaagccgacgaggcg
ctggtggacgaggcggtaaaggccgccgaggccgcgttctgggattacggctacacctcg
cgcaggacccgcgccgaattcctgaacaagatcgccgacgagatcgaaaagcgcggcagc
gacatcaccgcgatcgccatggcggaaaccggcctgccggaagcccgccttgaaggcgag
cgcggccgcacgacgggccagctccgcatgttcgcgcgccacattctggacggcgattat
ctcgaccgcaggcatgacgccgccaatcccgaggcgacgccgccttcgcccgatctgaag
atgatccagcgcccgatcggccccgtggccgtgttcggcgcttcgaatttcccgctggcg
ttttcaacggccggcggcgacaccgcttccgcccttgccgccggttgcccggtggtggtc
aagggccaccccgcccaccccggaaccggcgagatcgtggccgaggcgattgcggcggca
gcggagaaatgcggcattcatccgggcgtcttctcactgctgcagggcgcctcgcacgag
gccggcacgatgcttgtcacccatccgctgatcaaggcggtcggcttcaccggctcgctt
gccggcggcaaggcgctgttcgatctttgcgcccgtcgcgatgagccgatcccgttcttc
ggcgaactcggctcggtcaaccccaacttcctgctgccggacgcgctcgccaatcgcggc
agcgagatcgccaagggctgggccggctcgctgaccatgggcgtcggccagttctgcacc
aatccgggcctgatggtgacgctggccggtcccgaggccgaccggttcgccgaagaggcg
gcagaggagcttggcagggtcggcgcggccacgatgttgaccgacggcatagccgaggcc
ttccgcaagggcagcgatgcggttgcccatgcatccggggtcgaaacgctggtcaagctg
gaggcggatgggcgcaaggccgcgcccgcgctctacaaggtttccgccgcggcattcatc
gaaaacccggcgctcgcccatgaggtcttcggcccgctcggcatcattgtcgtggcgtcg
aacgcccaggagatgcgggctgtcgccgagcggctggagggccagctgacctgcacgctg
cacatggatcatgatgacgccgagttcgccggctcgctgctgccggtgcttgagcgcaag
gccggccggctgctcgccaacggattctcgaccggggtcgccgttgccgatgccatgatc
catggcggaccctacccggccaccaccaatttcggcggcacctcggtcggcaccatggcg
atacgccgtttcctgcggccggtctgctaccagaacatgccggcggcgctgctgccggaa
gatctgaggcatactggttag

DBGET integrated database retrieval system