KEGG   Martelella mediterranea: Mame_00888Help
Entry
Mame_00888        CDS       T04757                                 

Gene name
phbA_1
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mmed  Martelella mediterranea
Pathway
mmed00071  Fatty acid degradation
mmed00072  Synthesis and degradation of ketone bodies
mmed00280  Valine, leucine and isoleucine degradation
mmed00310  Lysine degradation
mmed00362  Benzoate degradation
mmed00380  Tryptophan metabolism
mmed00620  Pyruvate metabolism
mmed00630  Glyoxylate and dicarboxylate metabolism
mmed00640  Propanoate metabolism
mmed00650  Butanoate metabolism
mmed00900  Terpenoid backbone biosynthesis
mmed01100  Metabolic pathways
mmed01110  Biosynthesis of secondary metabolites
mmed01120  Microbial metabolism in diverse environments
mmed01130  Biosynthesis of antibiotics
mmed01200  Carbon metabolism
mmed01212  Fatty acid metabolism
mmed02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mmed00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mame_00888 (phbA_1)
   00630 Glyoxylate and dicarboxylate metabolism
    Mame_00888 (phbA_1)
   00640 Propanoate metabolism
    Mame_00888 (phbA_1)
   00650 Butanoate metabolism
    Mame_00888 (phbA_1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Mame_00888 (phbA_1)
   00072 Synthesis and degradation of ketone bodies
    Mame_00888 (phbA_1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mame_00888 (phbA_1)
   00310 Lysine degradation
    Mame_00888 (phbA_1)
   00380 Tryptophan metabolism
    Mame_00888 (phbA_1)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mame_00888 (phbA_1)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mame_00888 (phbA_1)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Mame_00888 (phbA_1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmed04147]
    Mame_00888 (phbA_1)
Enzymes [BR:mmed01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Mame_00888 (phbA_1)
Exosome [BR:mmed04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mame_00888 (phbA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AQZ50263
UniProt: A0A1U9YXT3
Position
971183..972364
Genome map
AA seq 393 aa AA seqDB search
MSGSAIVIAGAARTPIGVLGGALSSVPAHELGAVAIAEALTRSGVSPADVDEAILGQVLT
AGAGQNPARQAAMAAGMPAEKTAFVINQLCGSGLRAVALGMQQILAGDAEIVVAGGQESM
SLSPHCAHLRSATRMGDAAMVDTMLKDGLVDAFYGYHMGVTAENIAERWGLTRAVQDDYA
ARSQNRAEAARAAGHFAEEIVPVTVAARKSEVVVDQDEGIREGMTPHALERLRPAFMDGG
SVTAGNASGINDGAAALVLMDAANAERRGIEPLARIVSWATAGVDPQVMGTGPIPASQKA
LARAGWQVGDLDLIEANEAFAAQACAVVRELALDPEKVNVNGGAIALGHPIGASGARVLT
TLLYEMRRRDAKKGLATLCIGGGMGVAMCVERA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtccggttcggccattgttattgcaggcgcggcgcgcacgccgatcggcgttctgggc
ggcgcgctttccagcgtgcccgcccatgagctgggggccgtggcgatcgccgaagcgctt
acccggtcgggcgtttcgccggcggacgtcgacgaggcgatcctcggccaggtgctgacg
gcaggcgccggccagaaccccgcccgacaggcggcgatggccgccggcatgccggccgag
aaaaccgccttcgtcatcaaccagctctgcgggtcggggctcagggcggtcgcgctcggc
atgcagcagatccttgccggcgatgccgaaatcgtggtggcgggcggacaggaatcgatg
tcgctgtcgccgcattgcgcccatcttcgcagcgcaacgcggatgggcgacgccgccatg
gtcgacaccatgctgaaggacgggctggtcgacgccttctatggctatcacatgggcgtg
acggcggaaaacatcgccgagcgctggggcctgaccagggcggtgcaggacgattatgcc
gcccgctcgcaaaaccgcgccgaggccgcccgcgccgccggccacttcgccgaagagatc
gtgccggtcacggttgccgcccgcaaatccgaggtggtggtcgatcaggatgaaggcatc
cgcgagggcatgaccccgcacgcgctcgaacgcctgcgcccggccttcatggatggcggt
agcgtgaccgccggcaatgcctccggcatcaatgacggcgcggcggcgctggtgctgatg
gacgcggcaaacgctgaacggcgcggcatcgagccactggcgcggatcgtgtcctgggcg
accgccggcgtcgatccgcaggtcatgggcacgggcccgatcccggcatcgcaaaaggcg
ctggccagggccggctggcaggtcggcgatctcgatctgatcgaggccaacgaggcgttc
gcggcgcaggcctgcgcggtggtgcgcgaactggcgctcgatccggaaaaggtcaatgtc
aatggcggggcgatcgcgctcggccatccgatcggcgcgtccggcgcgcgggtgttgacg
accctgctttacgaaatgcgccggcgcgatgcgaaaaagggcctcgccacgctctgcatc
ggcggcggcatgggcgttgcgatgtgcgtggaacgcgcctga

DBGET integrated database retrieval system