KEGG   Martelella mediterranea: Mame_02696Help
Entry
Mame_02696        CDS       T04757                                 

Gene name
nagZ
Definition
(GenBank) Beta-hexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mmed  Martelella mediterranea
Pathway
mmed00520  Amino sugar and nucleotide sugar metabolism
mmed01100  Metabolic pathways
mmed01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:mmed00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Mame_02696 (nagZ)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Mame_02696 (nagZ)
Enzymes [BR:mmed01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Mame_02696 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: AQZ52021
UniProt: A0A1U9Z2V5
Position
2901644..2902642
Genome map
AA seq 332 aa AA seqDB search
MILGCAGARLSDEERAFFRAEQPWGFILFGRNVETMEQIRALTAELRAAVGRNAPVLIDQ
EGGTVRRLRPPLVRDYPPASVIGRLYASSPDEAKEAAYACGRLIAADLLSVGVDVDCAPV
LDMPPEPDTGFIANRAFGSDPEQVRVLAQAMADGLKAGGVLPVIKHMPGHGRGLADSHIG
LPVVKEPLALLAERDFRPFRELTGIRMAMTCHVLFEAVDAENPASASAKVVEQVMRGSIG
FDGLIISDDISMNALAGDIGERARAVAAAGIDIILHCNGKMDEMRAVADAAPALAGVSLI
RSDRALDGRPAADDANLAALSRRLDDILQARS
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgattctcggttgcgccggcgcccgcctcagcgacgaggagagggcattcttccgcgcg
gagcagccctggggcttcatccttttcggccgcaatgtcgagacgatggagcagataagg
gcgctgacggcggagttgcgcgcggctgtcggtcgtaatgccccggttctgatcgatcag
gagggcggcacggtgcgtcgtcttcgcccgccgctggtgcgcgattatccccccgcctcg
gtgatcggcaggctctacgccagctctcccgatgaggcgaaagaggcggcctatgcctgc
gggcggctgattgccgcggaccttctgtcggttggcgtcgatgtcgactgcgccccggtg
ctcgacatgccgccggaacccgataccggcttcatcgccaatcgcgccttcgggtctgac
ccggaacaggtgcgggttctggcgcaggccatggccgacgggctgaaggccggcggcgtg
ctgccggtgatcaagcacatgcccggccacgggcgcggccttgccgattcccatatcggc
ctgccggtggtcaaagagccgctggcgctgcttgccgagcgcgatttccggccgtttcgc
gagctgacaggcatccggatggcgatgacctgccatgtacttttcgaggcggtcgatgcc
gagaacccggcctcggcctcggcgaaggtggtcgagcaggtgatgcgcggctcgatcggt
ttcgacgggctgatcatctccgacgatatctcgatgaacgcgctggccggcgatatcggc
gagcgcgcccgtgctgtcgctgctgccggcatcgacatcatcctgcattgcaacggcaag
atggacgagatgcgcgccgtcgccgatgccgccccggcgcttgccggcgtatccctgatc
cgcagcgatcgcgcactggatggccgtcctgcggccgatgacgccaatctcgccgcgctg
tcccgccgtctcgacgacattcttcaggcgaggagctga

DBGET integrated database retrieval system