KEGG   Martelella mediterranea: Mame_03029Help
Entry
Mame_03029        CDS       T04757                                 

Gene name
scoA
Definition
(GenBank) putative succinyl-CoA:3-ketoacid coenzyme A transferase subunit A
  KO
K01028  3-oxoacid CoA-transferase subunit A [EC:2.8.3.5]
Organism
mmed  Martelella mediterranea
Pathway
mmed00072  Synthesis and degradation of ketone bodies
mmed00280  Valine, leucine and isoleucine degradation
mmed00650  Butanoate metabolism
mmed01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmed00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Mame_03029 (scoA)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Mame_03029 (scoA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mame_03029 (scoA)
Enzymes [BR:mmed01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     Mame_03029 (scoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans
Motif
Other DBs
NCBI-ProteinID: AQZ52348
UniProt: A0A1U9Z3U8
Position
3248740..3249453
Genome map
AA seq 237 aa AA seqDB search
MRKVFASATEALAGQLRDDMVIMSGGFGLCGIPEALIEAVELSGARNLTVISNNAGVDGI
GLGRLLETRQISKMISSYVGENKLFAEQYLAGDLELEFNPQGTLAERIRAGGAGIAAFYT
KTGVGTVIAEGKEVRSFNGEDYVMETGLVADISLVHAFKGDTEGNLVYRKTARNFNPDMA
TAARMTFAEVEHLVQPGEIDPDHIHTPGIFVSRIVHVPNPVKHIEKRTTREARREEA
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagtattcgcgtcggcgacagaagccctggccgggcagttgcgcgacgatatg
gtgatcatgtcgggaggcttcggcctttgcggcattcccgaagcgctgatcgaagccgtg
gagctttccggcgcgcgcaatctgacggtgatttcgaacaatgccggtgtcgacggcatc
ggccttggtcggcttcttgaaacccggcagatcagcaaaatgatctcgtcctatgtcggc
gagaacaagctgttcgccgagcagtatcttgcgggcgacctcgagctcgaattcaacccg
cagggcacgctcgccgaacgcatccgcgccggcggcgctggcattgcggcattctacacc
aagaccggcgtcggaaccgtgattgccgagggcaaggaagtccgcagcttcaacggcgag
gactatgtcatggagaccgggcttgtcgccgatatcagcctggtccacgccttcaagggc
gataccgagggcaatctggtctatcgcaagaccgcccgcaacttcaatccggacatggcc
acggcagcgcggatgacctttgccgaggtggagcatctggtgcagcccggcgagatcgat
cccgatcacattcacacgcccggcatcttcgtgtcgcgcatcgtccacgtcccgaatccg
gtcaagcacatcgaaaagcgcacaacgcgcgaagcccggcgggaggaagcataa

DBGET integrated database retrieval system