KEGG   Martelella mediterranea: Mame_03606Help
Entry
Mame_03606        CDS       T04757                                 

Gene name
ggt
Definition
(GenBank) Gamma-glutamyltranspeptidase precursor
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
mmed  Martelella mediterranea
Pathway
mmed00430  Taurine and hypotaurine metabolism
mmed00460  Cyanoamino acid metabolism
mmed00480  Glutathione metabolism
mmed01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmed00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Mame_03606 (ggt)
   00460 Cyanoamino acid metabolism
    Mame_03606 (ggt)
   00480 Glutathione metabolism
    Mame_03606 (ggt)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmed01002]
    Mame_03606 (ggt)
Enzymes [BR:mmed01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     Mame_03606 (ggt)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     Mame_03606 (ggt)
Peptidases and inhibitors [BR:mmed01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   Mame_03606 (ggt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept Calici_coat
Motif
Other DBs
NCBI-ProteinID: AQZ52911
UniProt: A0A1U9Z5F4
Position
3880974..3882776
Genome map
AA seq 600 aa AA seqDB search
MMRLIAGSAFVALLSVPAAAQQAADAVAPEIGTVEPGFSAASPEVEAALAAKAEGRPVEA
EKWMVAAANPLAVEAGARVLAEGGSAADAMVAVQAVLGLVEPQSSGMGGGAFLVWYDAAE
NRLTTLDGRETAPRAATPKLFLDDNGEPLQFYDAVVGGRSVGTPGTPMLMEAAHERWGKL
DWAGLFDDAIALASGGFAVSPRLAGQIAEDSERLGRFTTTADYFLPGGEPLAAGDQLQNP
AYAETLTALAADGADAFYSGAIAKDIVGTAQQAEGNPGLLALEDLAAYRVIERDPVCVAY
HGYDVCGMGPPSSGALTVGQILGLTAEKDLASLGPDNPESWRLIGDASRLAFADRGRYMA
DTDFVPMPLNGLVAPDYLGMRAKLLDGDHALETVEPGLPAWDHAMIRYGDGTAIELPSTT
QIVIVDADGNALSMTSTIENGFGSRLMTKSGFLLNNELTDFSFATHDEAGYPIANRVEPG
KRPRSSMAPTIVMKDGKPVLVIGSPGGSSIIGYVAQAVIAYLDWDMNVQEAVAMPHLLNR
FGTYDIEAGTSAEAMAAPLEAMGFKVKIGPQTSGLQAIAIKDGMLYGGADPRREGIALGE
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgatgagattaatcgcgggcagcgctttcgtggcgttgctttccgttccagccgcggcc
cagcaggccgccgacgccgtggccccggaaatcggcacggtggaacccggcttttccgcc
gcctcgcccgaggtcgaagccgcccttgccgccaaggccgaaggccggcccgtcgaggcc
gagaaatggatggttgccgccgccaatccgcttgccgtggaagccggcgcgcgggtgctc
gccgagggcggcagcgccgccgacgccatggtggcggtgcaggcggttctcggcctcgtc
gagccgcaatcctccggcatgggcggcggtgcgtttctggtctggtacgatgccgcggaa
aaccggctgacgacgctggacggccgcgagaccgcgccgcgcgcggcgacgccgaaactg
tttctcgatgacaatggcgaaccgcttcagttctatgatgccgtggtcggcggccgctcg
gtcggcacgcccggaacgccgatgctgatggaggcggcgcatgagcgctggggcaagctc
gactgggccggcctgttcgatgatgcgatcgcgctcgcctcgggtggctttgccgtttcg
ccccgccttgccggacagatcgccgaggacagcgaacggcttggccgattcaccaccacc
gccgattatttcctgcccggcggtgaaccgcttgccgccggcgatcagctccagaacccg
gcctatgccgaaacgctgacggcactcgcggcagatggcgctgacgctttctattccggc
gcaatcgctaaggatatcgtcggcaccgcacaacaggccgaaggcaaccccggcctgctg
gcgctggaggatctcgccgcctatcgggtgatcgaacgcgatccggtgtgcgtggcctat
cacggctacgacgtctgcggcatggggccgccctcctccggcgcgcttaccgtcggccag
atcctcggcctcactgccgagaaggacctcgcatcgctcgggcctgacaatccggaaagt
tggcggctgatcggcgatgcctcgcgcctcgccttcgccgatcgcggccgttacatggcc
gacaccgatttcgtaccgatgccgctgaacgggctggtcgctccggactatctggggatg
cgcgcgaaactgcttgacggcgaccacgcgctggagaccgtggagcccggccttcccgcc
tgggatcacgctatgatccgctatggcgacgggacggcgatcgaactgccgtccaccacc
cagatcgtgattgtcgatgccgatggcaacgcgctttcgatgacctccaccatcgaaaac
ggcttcggcagccggctgatgacgaagtcgggctttctgctgaacaacgagctcaccgac
ttctccttcgccacccatgacgaggccggctatccgatcgccaaccgcgtcgaacccggc
aagcggccgcgctcgtcaatggcgccgaccatcgtgatgaaggacggcaagccggttttg
gtcatcggctcgccgggcggcagttcgatcatcggctatgtcgcgcaagccgtgatcgcc
tatctcgattgggacatgaacgtgcaggaggccgtcgccatgccgcatctgctgaaccgc
ttcggcacttatgatatcgaggcgggaaccagtgcggaagccatggcagcgccgctggaa
gcgatggggttcaaggtgaagatcggtccgcaaacctccggcctgcaggcgatcgccatc
aaggatggcatgctctacggcggagcggacccgagacgcgaaggcattgcgcttggggag
taa

DBGET integrated database retrieval system