KEGG   Methanococcoides methylutens: MCMEM_1985Help
Entry
MCMEM_1985        CDS       T03913                                 

Definition
(GenBank) N5-methyltetrahydromethanopterin:coenzyme M methyltransferase subunit B
  KO
K00578  tetrahydromethanopterin S-methyltransferase subunit B [EC:2.1.1.86]
Organism
mmet  Methanococcoides methylutens
Pathway
mmet00680  Methane metabolism
mmet01100  Metabolic pathways
mmet01120  Microbial metabolism in diverse environments
mmet01200  Carbon metabolism
Module
mmet_M00357  Methanogenesis, acetate => methane
mmet_M00567  Methanogenesis, CO2 => methane
mmet_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mmet00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    MCMEM_1985
Enzymes [BR:mmet01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     MCMEM_1985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrB
Motif
Other DBs
NCBI-ProteinID: AKB86038
UniProt: A0A0E3STB7
Position
2151027..2151350
Genome map
AA seq 107 aa AA seqDB search
MSMVHIAPEAHLVLDPLTSVLAEEREDIICYSMDPIMEQIDELDKIADDLINSLAPDRKL
LNSYPGRENTSLKAGFYGNTFYGVVVGLVFSGMVALALYILSLIGGL
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgagcatggtacacattgcaccagaagcacatcttgtactggacccattgacatcagtc
ctggcagaagagcgtgaagacatcatctgctattcaatggaccctatcatggaacagatc
gatgagcttgacaagatagctgatgatcttatcaattcactcgcacctgacaggaagctg
ttgaactcatacccgggaagggagaacacatcactcaaagcaggtttctacggaaacacc
ttctacggagttgttgtcggtcttgtattctcaggaatggtcgcacttgccctgtacata
ctcagtctgatcggaggactctaa

DBGET integrated database retrieval system