KEGG   Methanothermobacter marburgensis: MTBMA_c00590Help
Entry
MTBMA_c00590      CDS       T01297                                 

Gene name
trpB1
Definition
(GenBank) predicted tryptophan synthase, beta chain
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mmg  Methanothermobacter marburgensis
Pathway
mmg00260  Glycine, serine and threonine metabolism
mmg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mmg01100  Metabolic pathways
mmg01110  Biosynthesis of secondary metabolites
mmg01130  Biosynthesis of antibiotics
mmg01230  Biosynthesis of amino acids
Module
mmg_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mmg00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MTBMA_c00590 (trpB1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MTBMA_c00590 (trpB1)
Enzymes [BR:mmg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MTBMA_c00590 (trpB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADL57669
UniProt: D9PTX1
Position
complement(54533..55819)
Genome map
AA seq 428 aa AA seqDB search
MNKIVLDENEIPKKWYNINPDLPSPLPEPRNPEGGENIENLPRVFSRGVLEQEMSMERWI
KIPREVRDVYKMIGRPTPLFRAKGLEEMLDTPARIYYKREDYSPTGSHKLNTAIAQAYYA
REDGAERLTTETGAGQWGTALSLACSLMDLQCKVYMVRVSFNQKPFRKTIMQLYGGEVVP
SPSDHTEFGRKILSEDPEHPGSLGIAISEAMEEALQYENVYYSLGSVLNHVLLHQTVIGL
ETQKQLEIAGETPDVMIGCVGGGSNFGGAVFPFIKDKLDGKLDCEFIAAEPRSCPTLTQG
EYRYDFGDTAGMTPLLKMYTLGHDFVPPSVHAGGLRYHGMSPQVALLVKEGIIKARAVEQ
HKIFESGVKFAKAEGVVPAPETCHAISVAMDEARKCRETGEEKTIVVSFSGHGLLDLKGY
GDYLEGKI
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagattgttcttgacgaaaatgaaataccaaaaaaatggtacaacatcaacccg
gacctgccatcaccactaccagaacccagaaaccctgagggcggagagaacatagagaac
cttccaagggtgttctcaaggggggttcttgagcaggagatgtcaatggagcgctggata
aagatcccccgtgaggtcagagatgtctacaagatgatcggaagacccaccccactcttt
cgagcaaagggccttgaggagatgcttgacacccccgccaggatatactacaagagggag
gattattcacccacaggaagccacaagctcaataccgcgatagcacaggcatactatgcc
cgtgaagatggagctgaaaggctcacaacagaaacaggcgctggacagtggggaaccgcc
ctctcacttgcatgttcactcatggacctccagtgcaaggtctacatggtcagggtttcc
ttcaaccagaagcccttcaggaaaacaataatgcagctctatggtggcgaggttgtccca
tcaccaagtgaccataccgaattcggaaggaaaatactcagtgaggacccagaacacccg
ggctcccttggtatagccatatcagaggccatggaggaggccctccagtatgaaaacgtt
tactactcccttggaagcgtcctcaaccacgttctgctacaccagaccgtgataggtctt
gaaacacagaaacagctggaaatagcaggtgaaacacctgacgtcatgataggatgtgtg
ggtgggggcagcaactttggcggggcggtttttccattcataaaggataaacttgatggt
aagctcgactgtgaattcatagcagctgaaccaagatcctgcccgaccctcacccaggga
gaataccggtatgactttggtgacactgctggtatgacaccactcctcaagatgtacaca
ctaggccacgactttgtacccccatctgtacatgcaggcggtctgaggtaccatggaatg
tcaccgcaggttgcactgctggtgaaggagggcatcatcaaggcccgggccgtagaacag
cataaaatatttgagagcggtgttaaatttgcaaaggccgagggggttgttcctgcacca
gagacctgccacgccataagtgttgccatggatgaggccagaaagtgcagagagaccggt
gaggaaaaaaccatagtcgtaagcttctctggccacgggctcctggacctcaagggttac
ggggactatcttgagggcaaaatctga

DBGET integrated database retrieval system