KEGG   Methanothermobacter marburgensis: MTBMA_c11830Help
Entry
MTBMA_c11830      CDS       T01297                                 

Gene name
cbiP
Definition
(GenBank) cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
mmg  Methanothermobacter marburgensis
Pathway
mmg00860  Porphyrin and chlorophyll metabolism
mmg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MTBMA_c11830 (cbiP)
Enzymes [BR:mmg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     MTBMA_c11830 (cbiP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 AAA_26 CbiA SNO GATase DUF1611 MobB Peptidase_C26
Motif
Other DBs
NCBI-ProteinID: ADL58775
UniProt: D9PX27
Position
1095295..1096812
Genome map
AA seq 505 aa AA seqDB search
MSSKCIMVQGTSSSAGKSVLVAALCRIFSKRGYRVAPFKSQNMSLNSFTTHENREIAVAQ
VLQAEAAGIRPSYHMNPILLKPKEDFTSQVIVHGRPAGNMNFQEYQTGFRETALKAIRES
LDYLKERYDIIVIEGAGSPAEINMRDRDLANMEIAHLADADVILVADIDRGGVFASIAGT
LMLLDKRDRSRIKGVVINKFRGNLEILMPGIERIEEITGVPVLGVLPYDESLKLPEEDSA
SLAERKYRGRGDVKIGVMRLPRISNFTDIDPLEYEEDVAVRLIEAGDSLEGLDAIIIPGT
RNTISDLMYLRDNGFADEIRDLSREIPVFGICGGFQMLGRSIIDEGLQESKLGSVDGLNL
LDCKTTFTGDGKIISRSEGEITGAGLFSGIAGETVEGYELHEGTTVLGYVKPLMKVKRGF
GNTYTMGFDGAADGNVAGTYFHGIFHNFRFRRYFTNLLRERKGLEKLDYVDDHFDASRRF
SIDRLAEIVEENMDLSIIEDIIEGD
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgagttcaaaatgtataatggtgcaggggacatcatcaagtgccggtaagagtgtcctt
gtggctgcactctgccgcatattctcaaagaggggctaccgggttgcccccttcaaatcc
cagaacatgtcactgaattccttcacaacccatgagaacagggagatagcggtggcccag
gtcctccaggcagaggctgcaggcatcaggccatcatatcacatgaaccccatactcctc
aaacccaaggaggacttcacatcccaggtcatagtccacggcagacccgccgggaacatg
aacttccaggagtaccagacagggttccgggaaaccgcccttaaggccataagggagtcc
cttgattaccttaaggagcgatatgatatcatcgtgattgagggggccggatcccctgcc
gaaataaacatgagggaccgcgaccttgccaatatggaaatagcccaccttgcagacgcc
gatgttatacttgttgctgatatagaccgtgggggagttttcgcctcaattgcaggcacc
ctgatgcttctcgataagcgtgacaggtcccggataaagggtgttgtcataaacaagttc
aggggaaaccttgaaatcctcatgcccggtatagaaaggattgaggaaataacaggggtg
cctgtgcttggtgtgctcccctacgacgagagtctgaagcttcctgaggaggattcagcc
tcgctcgcagagcggaagtaccgtggaaggggtgatgtgaagatcggtgtcatgaggctt
ccccgaatatccaacttcacagacatagacccccttgagtacgaggaggacgttgccgtg
aggctcatagaggccggtgacagcctcgagggccttgacgccatcataatccctggaacc
aggaacaccataagcgacctcatgtatctgagggataatggctttgccgatgagatcagg
gatctgagccgtgagataccagtattcggtatatgcggtggttttcagatgcttgggagg
agtatcattgatgaggggcttcaggagtcaaagctgggaagcgtggatggcctcaacctc
cttgactgcaaaaccacattcacaggtgatggtaagataatatcccggagtgaaggggag
ataaccggtgccggcctgttctcaggtattgcaggggaaaccgtggagggctatgagctc
catgagggaaccacagtcctgggttatgttaaaccactcatgaaggtgaagaggggcttt
ggtaacacatacaccatgggattcgatggtgccgccgatgggaacgtggcgggtacctac
ttccacggcatattccacaacttcagattcaggaggtacttcaccaaccttctgagggag
aggaagggtcttgaaaagcttgactatgtggacgaccacttcgatgcctcaaggaggttc
tcaattgaccgcctggcggagatagtcgaggagaacatggacctatccatcattgaggac
atcatagaaggggattag

DBGET integrated database retrieval system