KEGG   Methanothermobacter marburgensis: MTBMA_c13910Help
Entry
MTBMA_c13910      CDS       T01297                                 

Gene name
gap
Definition
(GenBank) glyceraldehyde 3-phosphate dehydrogenase
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
mmg  Methanothermobacter marburgensis
Pathway
mmg00010  Glycolysis / Gluconeogenesis
mmg01100  Metabolic pathways
mmg01110  Biosynthesis of secondary metabolites
mmg01120  Microbial metabolism in diverse environments
mmg01130  Biosynthesis of antibiotics
mmg01200  Carbon metabolism
mmg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MTBMA_c13910 (gap)
Enzymes [BR:mmg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     MTBMA_c13910 (gap)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N Sacchrp_dh_NADP 2-Hacid_dh_C GFO_IDH_MocA NAD_binding_3 3HCDH_N TrkA_N Semialdhyde_dh F420_oxidored DUF348 Phos_pyr_kin MacB_PCD
Motif
Other DBs
NCBI-ProteinID: ADL58978
UniProt: D9PXN0
Position
1282837..1283850
Genome map
AA seq 337 aa AA seqDB search
MISVAINGYGTIGKRVADAVAAQDDMKVVGVSKTKPDFEARVAIEKGYDLYVSIPEREKL
FDDAGIPVSGTVKDMLEEADIVVDATPEGIGAKNLELYREKGIKAIFQGGEKHDAIGLSF
NSFTNYEESLGADYTRVVSCNTTGLCRTLKPIDDLCGIKKVRAVMVRRGADPVQVKKGPI
NAIVPNPPTVPSHHGPDLKTVMKGVNIHTVALLVPTTLMHQHNIMVELENPVDADEIKAK
LDETTRVMLVKASEGLASTAEIMEYAKELGRSRNDLFEIPVWEESINVVEGELFYMQAVH
QESDAVPESVDAIRALLELEEDNMKSIMKTNRAMGIL
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgatatctgtagccattaacgggtatgggacaataggaaagagagtcgccgacgctgtg
gctgcccaggacgacatgaaggtcgttggtgtcagcaaaacaaaacctgattttgaggcg
agggttgcgattgaaaagggctatgacctctatgtaagcatccctgaacgtgaaaagctc
tttgatgatgcaggaatccctgtgagcggtaccgtgaaggacatgctggaggaagcagac
atcgtggttgatgcaacaccagagggcatcggtgccaagaaccttgaactgtaccgtgaa
aagggaataaaggccatattccagggtggtgaaaagcacgacgccattggactctccttc
aactccttcacaaactacgaagagtcactgggggccgactacacaagggttgtttcctgc
aacaccaccggcctctgcaggaccctcaaaccaatagatgacctctgcgggataaaaaag
gtaagggcagtgatggtaagaaggggtgctgaccctgtacaggtgaaaaagggtccaata
aatgccattgtaccaaaccccccaacggtcccctcacaccacggacctgacctcaaaacc
gtcatgaagggcgttaatatccacaccgttgcactccttgtccccacaacactgatgcac
cagcacaacataatggtggaactggagaaccctgtggacgccgatgagataaaggcgaag
ctcgatgagacaaccagggtcatgcttgtgaaggcctcagagggccttgcatcaaccgca
gagataatggagtacgccaaggaacttggaaggtcaaggaatgacctcttcgagatacct
gtctgggaggagtccataaacgtggttgaaggggaactattctacatgcaggcggtccac
caggaatccgatgccgtccccgagagtgtggatgcaataagggccctccttgaacttgaa
gaggacaacatgaagtccataatgaagaccaacagggccatgggcatactctaa

DBGET integrated database retrieval system