KEGG   Methanothermobacter marburgensis: MTBMA_c13950Help
Entry
MTBMA_c13950      CDS       T01297                                 

Gene name
cysG2
Definition
(GenBank) predicted siroheme synthase
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
mmg  Methanothermobacter marburgensis
Pathway
mmg00860  Porphyrin and chlorophyll metabolism
mmg01100  Metabolic pathways
mmg01110  Biosynthesis of secondary metabolites
mmg01120  Microbial metabolism in diverse environments
Module
mmg_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mmg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MTBMA_c13950 (cysG2)
Enzymes [BR:mmg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     MTBMA_c13950 (cysG2)
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     MTBMA_c13950 (cysG2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 2-Hacid_dh_C IlvN THF_DHG_CYH_C Shikimate_DH CRISPR_Cas2 F420_oxidored 3HCDH_N AdoHcyase_NAD Pyr_redox_3 ELFV_dehydrog Rossmann-like DUF2536 2-Hacid_dh adh_short
Motif
Other DBs
NCBI-ProteinID: ADL58982
UniProt: D9PXN4
Position
complement(1287549..1288166)
Genome map
AA seq 205 aa AA seqDB search
MSLTPLYIDMEGKRVLVVGSGEVGRRRAMRFIEAGAEVAVLGQEVEGAVSITEEKLEEWI
KKADLIVAASPDRSLNERVTELAGGKLLNRADDPSRGNVVVPSTFKIADVSISVFTGKKS
PLMAKYLRRRIQEAIKPEDILMIEVQDVSRRMLMEEVQDHRKRRRILYEISEDKMVQEKL
EAGDLEGAIRRARDIIMDRGASGDS
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgtccctcacacccctctacattgacatggaaggtaagagggtactcgtggtgggttca
ggtgaagttggaagaagaagggcgatgaggttcatcgaggccggtgcagaggtcgcggtt
cttggacaggaagttgaaggcgctgtttcaatcacagaagaaaaacttgaggagtggatt
aagaaggcagacctcatagttgccgcaagtcccgatagaagcctcaatgaaagggtaact
gaacttgcaggtggcaaactccttaaccgggcagatgacccatcaaggggtaacgtggtt
gtcccatcgacattcaaaatagcggatgtttcaatctcagtattcacaggtaaaaagagt
ccacttatggcaaaataccttcgcaggaggatccaggaggccataaaaccagaggatata
ctaatgattgaggttcaggatgtatcccgccgcatgctaatggaagaggtccaggatcac
agaaagaggcgcagaattctctatgagatctcagaggataaaatggtacaggaaaaactt
gaagctggtgatctggagggtgccataagaagggctcgggacataatcatggataggggg
gcttcaggtgattcttaa

DBGET integrated database retrieval system