KEGG   Methanothermobacter marburgensis: MTBMA_c14180Help
Entry
MTBMA_c14180      CDS       T01297                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mmg  Methanothermobacter marburgensis
Pathway
mmg00020  Citrate cycle (TCA cycle)
mmg00640  Propanoate metabolism
mmg00660  C5-Branched dibasic acid metabolism
mmg00720  Carbon fixation pathways in prokaryotes
mmg01100  Metabolic pathways
mmg01110  Biosynthesis of secondary metabolites
mmg01120  Microbial metabolism in diverse environments
mmg01130  Biosynthesis of antibiotics
mmg01200  Carbon metabolism
Module
mmg_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mmg00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MTBMA_c14180 (sucC)
   00640 Propanoate metabolism
    MTBMA_c14180 (sucC)
   00660 C5-Branched dibasic acid metabolism
    MTBMA_c14180 (sucC)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MTBMA_c14180 (sucC)
Enzymes [BR:mmg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     MTBMA_c14180 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A CPSase_L_D2 ATP-grasp Peripla_BP_3
Motif
Other DBs
NCBI-ProteinID: ADL59005
UniProt: D9PXQ7
Position
1306067..1307167
Genome map
AA seq 366 aa AA seqDB search
MKFYEYSAKELFRSEGIPVPEGSVARTPQEASEVAENIDSEVAIKAQVLTGGRGKAGGIR
FAKPETAADVASDLLASRVKGEEVKSVLVERKISIDREFYVSVVIDRAARMPLIMASSEG
GVDIEELAAESPDKIVRYHVNPLDEFLPYEAREIARKMGLESELIPKVGAVIWKLYHLFR
KYDARLAEINPLVLSGDDVIAADAKLEVDDDSIYRHREFMELDEYEPEEFAFVKLDGDIA
VIGNGAGLTLTAMDLIKLKGGEPATFLDIGGGASEDIIRRAINLVISHPDVKVVFLNVLG
GITRADDVARGVVNALKDAERDVPLVIRLTGTNEEEGQRILKDAGIPFETSLERAAEKAV
EISKAL
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaagttttacgagtacagcgccaaggaactcttcaggagtgagggcatacccgtccca
gagggatccgttgccaggaccccccaggaggcatcggaggtcgctgagaatattgactca
gaggtggccattaaggcacaggtcctaaccggtggccggggaaaggcggggggtataaga
tttgcaaaaccagaaactgcggctgatgttgcttctgatctcctcgcatcccgggttaag
ggtgaggaggttaaatctgtcctggttgaaaggaagatttccatcgacagggaattctat
gtgagcgtcgttattgatagggcggccaggatgccccttataatggcaagcagtgagggc
ggggttgatattgaggagcttgcagcagaatcccccgataagatagtgcgttaccatgta
aacccccttgacgagttcctcccctacgaggcaagggagatcgcaaggaagatgggtctt
gaaagtgaactcataccaaaggtgggggctgtgatatggaagctctaccatctcttcagg
aagtacgatgcgaggcttgccgagataaaccctcttgtactttcaggtgatgatgttatt
gcagcagatgcaaagcttgaggtggatgatgactccatctaccgtcaccgtgaattcatg
gaactggatgagtatgaaccggaggaattcgcctttgttaaacttgacggtgatattgca
gtgatagggaatggtgctggccttaccctcaccgccatggacctcataaaactgaagggg
ggtgaacccgccaccttccttgatataggtggtggtgcctcagaggacatcataaggagg
gccataaacctggtaatatcccaccctgatgtgaaggtggtgttcctgaatgtgcttggc
ggtataacaagggcagatgatgttgcaaggggtgttgtgaatgccctgaaggatgccgag
agggatgtgccccttgtaataaggctcacaggaaccaatgaggaggagggtcagaggata
ctcaaggatgcggggattccctttgagacttcccttgagagggccgctgagaaggctgtt
gaaatatcaaaggccctctga

DBGET integrated database retrieval system