KEGG   Methanothermobacter marburgensis: MTBMA_c14500Help
Entry
MTBMA_c14500      CDS       T01297                                 

Definition
(GenBank) N5-methyltetrahydromethanopterin-coenzyme M methyltransferase, subunit A related protein
  KO
K00577  tetrahydromethanopterin S-methyltransferase subunit A [EC:2.1.1.86]
Organism
mmg  Methanothermobacter marburgensis
Pathway
mmg00680  Methane metabolism
mmg01100  Metabolic pathways
mmg01120  Microbial metabolism in diverse environments
mmg01200  Carbon metabolism
Module
mmg_M00357  Methanogenesis, acetate => methane
mmg_M00567  Methanogenesis, CO2 => methane
mmg_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mmg00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    MTBMA_c14500
Enzymes [BR:mmg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     MTBMA_c14500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrA
Motif
Other DBs
NCBI-ProteinID: ADL59029
UniProt: D9PXT1
Position
complement(1332533..1333090)
Genome map
AA seq 185 aa AA seqDB search
MVDKKVDKKPVPEDWPHIVGDYVVGDAESPVAVVTLGSHMEDEPVRAGAAISGPLHTENL
GIEKVVGNVIANPNLRFLLVCGAEVMGHITGQTMKALHSNGVDGETGRIIGATGAIPYIE
NMPDEAIERFRRQVELVDMVDVEDPAAIRERIGECVVHDSGAIDEEPLILRPSEDLNKNK
PDENT
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggttgacaagaaggttgacaagaaaccggtacccgaggactggccccacatagttggg
gactatgtggttggtgatgccgaaagtccggttgcggttgtcaccctcgggtcccacatg
gaagatgagcctgtaagggcaggcgcagcgatttcaggtccactgcacacagagaacctt
ggaatagagaaggtcgttggtaatgtaattgcaaaccccaacctcagattccttcttgta
tgcggtgcggaggtcatgggtcacatcactggtcagaccatgaaggccctccacagcaat
ggggttgatggagaaaccgggaggataatcggggccaccggtgccatcccctacatagag
aacatgcctgatgaggccatagagaggttccgaaggcaggtggaacttgttgacatggta
gatgttgaggatcccgctgcaataagagaaagaataggggagtgtgtggtgcatgactca
ggggcaattgatgaggagcccctcattttaaggccttctgaggatctgaataaaaataaa
cccgatgaaaacacctga

DBGET integrated database retrieval system