KEGG   Methanohalophilus mahii: Mmah_0081Help
Entry
Mmah_0081         CDS       T01211                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase (GDP); mannose-6-phosphate isomerase, type 2
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
mmh  Methanohalophilus mahii
Pathway
mmh00051  Fructose and mannose metabolism
mmh00520  Amino sugar and nucleotide sugar metabolism
mmh01100  Metabolic pathways
mmh01110  Biosynthesis of secondary metabolites
mmh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mmh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Mmah_0081
   00520 Amino sugar and nucleotide sugar metabolism
    Mmah_0081
Enzymes [BR:mmh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     Mmah_0081
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     Mmah_0081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer NTP_transferase Cupin_2 NTP_transf_3 AraC_binding IspD DUF3046
Motif
Other DBs
NCBI-ProteinID: ADE35617
UniProt: D5E8V8
Position
85866..87248
Genome map
AA seq 460 aa AA seqDB search
MVNNMKSIILAGGSGTRLWPLSREHYPKQFLKIGEYSLFQQTFLRCSEVSDVSEIFVVTN
EDQKFYVIGQIQELGYDYPKENVLIEPEGKNTLPAICFGMKEIQERFGESNAGIFSSDHV
LDSRAMQTISEAKSLASRGYLLTFGIKPTSPNTGYGYIKPAENLGIGQKVSEFREKPDEE
TARRYIEESCLWNSGMFLFNTETFFSELAQCAPDIYESFEQNEDINQIYAELPSISVDYG
VMEKSQKVAVVPLQYKWSDLGNFAALYDELDKDSDENVVYDCELLPLDSRQNLVHSRNGK
LVSLIDVNDMIVVDTPDALLISPKESSQKVKQIVNQLKEKNDPRAKIGQTVYRPWGSYTV
LESSDNHVIKKIVVMPEQKLSLQLHYHRSEHWVVVTGMAEVHVNGDDYFVRPGESTFIRA
GERHRLGNPSKIPLEIIEVQLGEYVAEDDIVRFDDVYGRQ
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
ttggtgaacaacatgaaatccatcattcttgcaggaggctccggtacacgtctctggccg
ctcagcagagagcattatccgaaacagttcttaaaaatcggggaatattccctcttccag
cagactttcctgcgctgcagtgaagtatctgatgtatcggaaatattcgtggttaccaat
gaggaccagaaattctatgtcataggccagatacaggaattgggatacgattaccccaaa
gagaatgtactcatcgagcctgaaggcaaaaataccctgcctgcgatctgtttcgggatg
aaggaaattcaggagaggttcggggaatccaatgcaggcattttctcttctgatcatgtg
ctggattctcgggccatgcaaaccatttcagaggcaaaatccctggcatcccggggttat
cttttaacttttggtatcaaaccgacctctccaaatacaggttatggctacattaagcct
gctgagaatctgggtatcggacaaaaagtctccgagttcagggaaaaacctgatgaagaa
accgctcgccggtatattgaggaaagctgtctctggaacagtggcatgttccttttcaat
acggaaacttttttcagtgaactggcacagtgtgcgcctgacatctacgaatcatttgaa
cagaatgaagatataaaccagatttatgcagagttaccttccatatctgtggactacggt
gtcatggaaaaatcacagaaagtggccgtagttcccttgcaatacaagtggagtgacctg
ggcaattttgccgctctctatgatgaactggataaggattcagatgagaatgtggtgtat
gactgtgaacttctgccccttgattctcggcagaatctggtacattccagaaatgggaaa
ctcgtctccttgatcgatgtgaatgacatgatcgtcgtggatactccggatgccctgctc
ataagtcctaaagagagcagccagaaggtcaagcagattgtgaatcaactcaaggaaaag
aatgatccacgtgctaagatcggccagactgtgtatcggccctggggttcctatacagtc
cttgaatcttccgataatcatgtgatcaagaaaatagtggtcatgccagagcaaaaactc
agtctccaattgcattatcacaggagtgagcactgggtggttgtaacaggcatggctgaa
gtacatgtcaatggcgacgattattttgtcaggcctggtgaaagtacctttattcgtgca
ggagaaagacacaggctgggcaatcctagcaaaatccccctggagataattgaagtacag
ctgggagaatatgtggcagaggatgatatcgtcaggtttgatgatgtgtatgggcggcag
taa

DBGET integrated database retrieval system