KEGG   Methanohalophilus mahii: Mmah_1203Help
Entry
Mmah_1203         CDS       T01211                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mmh  Methanohalophilus mahii
Pathway
mmh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mmh01100  Metabolic pathways
mmh01110  Biosynthesis of secondary metabolites
mmh01130  Biosynthesis of antibiotics
mmh01230  Biosynthesis of amino acids
Module
mmh_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mmh00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mmah_1203
Enzymes [BR:mmh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Mmah_1203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS DHO_dh
Motif
Other DBs
NCBI-ProteinID: ADE36707
UniProt: D5EC06
Position
1227351..1228151
Genome map
AA seq 266 aa AA seqDB search
MHPKIEQIVQKSKERADALSENKTHTICNDRRDIFESIGLACKKGHIPIIAEVKPASPTG
KFADVNPEIASQIACDMENAGAVALSVLTEPCYFEGSIENLESARKNTSIPVLRKDFIVD
KSQMHEASSDLILLIAGVLGKKLPEFIEIARRRNIEPLVEVHDEKELEYVLECDTNLIGI
NNRSFETLEIDLETAEKLIPLVKEHDRKYNQKHLIIGESGVKGTDDATRMIRAGADALLV
GTYLMEGNLKEKMKHLIEANKNQEIV
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgcatccgaagatcgaacaaatagtccaaaaatcaaaagaaagggcagacgcactttct
gaaaataaaacacacactatatgtaatgatagaagggatattttcgaatctatcgggctt
gcctgtaaaaaaggacacatacccataattgccgaagtaaagcctgcttcaccaacaggc
aaatttgctgatgtaaacccggaaatagcctcacaaattgcctgtgatatggaaaatgct
ggagctgtagccttatcagtccttacggaaccctgttactttgagggaagtatagaaaac
cttgaaagtgcaaggaaaaatacttccattccagttttacgcaaagattttattgtggac
aaaagtcagatgcatgaagcaagcagtgatctcatattgttgattgcaggggtactgggc
aaaaagctaccggaattcatagaaatagctcgaagaaggaacatagagcctctggtagag
gtacacgatgaaaaagagcttgaatatgtacttgaatgtgatacaaatcttatagggata
aataaccgcagttttgaaacccttgaaatcgatctggaaaccgctgaaaagctcattccc
cttgtgaaagaacatgaccgtaaatacaaccagaaacacctgataataggggaaagtgga
gtcaagggcacagatgatgcgacaaggatgatcagggcaggtgctgacgcgttgcttgtt
gggacctacctgatggaaggcaatcttaaagaaaaaatgaaacatcttattgaagcgaat
aagaatcaggagatagtatga

DBGET integrated database retrieval system