KEGG   Methanohalophilus mahii: Mmah_1459Help
Entry
Mmah_1459         CDS       T01211                                 

Definition
(GenBank) porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
mmh  Methanohalophilus mahii
Pathway
mmh00860  Porphyrin and chlorophyll metabolism
mmh01100  Metabolic pathways
mmh01110  Biosynthesis of secondary metabolites
mmh01120  Microbial metabolism in diverse environments
Module
mmh_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mmh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mmah_1459
Enzymes [BR:mmh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Mmah_1459
Exosome [BR:mmh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mmah_1459
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ADE36957
UniProt: D5E719
Position
1456163..1457140
Genome map
AA seq 325 aa AA seqDB search
MYPNTRMRRLRNGKIGNLIRETSLGLDDLIYPMFVDETAESTVEVPSMEGVLRLPLSEVV
NEARNVADLGISSLILFGIPSNKDEKGSSACGDEDIVQQATRAIKEELGDDMVVITDVCM
CEYTSHGHCGIIDNETHDVINDETLPLLGEIAASHARAGADMVAPSGMMDGMVGAIRQSL
DQENFSDVPIMSYAAKYCSAFYGPFRDAADSCYCFGDRSTYQMDPANSDEALREVELDIM
EGADIVMVKPALPYLDIIYRIKQEFGMPTAAYNVSGEYSMLKAAAQQGWLDEKKVMYESL
MSIKRAGADMIITYFAKEMAQLLNE
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgtacccaaatactcgaatgcgcaggctcaggaacggaaagataggtaatcttatacgt
gaaacttccctggggctagatgacctcatataccccatgtttgttgacgaaaccgcagaa
tccacagtcgaagtaccatccatggaaggtgtcctgaggttgcccctttccgaggttgtc
aatgaggccaggaatgtggcggacctgggcatcagttcattgatcctttttggaattcct
tcaaacaaggacgaaaagggaagcagtgcttgtggggacgaggatattgtccagcaggcc
acgcgtgctatcaaggaggaacttggtgacgatatggttgtgattacggatgtctgcatg
tgtgaatacacatcccacggccattgcggcattattgataatgaaacccatgatgtgatt
aatgatgagaccctgccccttttgggtgagattgcggcaagccatgccagggcaggcgca
gatatggtagccccctcgggtatgatggacggcatggtgggtgcaatcaggcaatccctg
gatcaggaaaatttcagtgatgtgcccattatgtcctatgctgcaaaatactgttccgca
ttttacggccccttcagggatgctgctgattcatgctattgtttcggagatcgctctaca
taccagatggaccctgcaaattcggatgaggccctgagggaagtagaactggatatcatg
gaaggtgccgacatcgtcatggtaaaaccggctcttccctaccttgatatcatctaccgg
ataaaacaggagtttggtatgccaactgcagcttacaatgtcagcggggaatactccatg
ttaaaggcagccgcccagcagggttggctggatgagaaaaaggtcatgtacgaatccctt
atgtcaataaaaagagctggagcggatatgataattacttactttgccaaggaaatggca
caattactgaatgaataa

DBGET integrated database retrieval system