KEGG   Methanohalophilus mahii: Mmah_1581Help
Entry
Mmah_1581         CDS       T01211                                 

Definition
(GenBank) SSU ribosomal protein S6P modification protein
  KO
K15740  tetrahydromethanopterin:alpha-L-glutamate ligase [EC:6.3.2.33]
Organism
mmh  Methanohalophilus mahii
Pathway
mmh00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:mmh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mmah_1581
Enzymes [BR:mmh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.33  tetrahydrosarcinapterin synthase
     Mmah_1581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RimK GSH-S_ATP ATPgrasp_Ter ATP-grasp_3 ATPgrasp_YheCD ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ADE37077
UniProt: D5E7D9
Position
1575020..1575925
Genome map
AA seq 301 aa AA seqDB search
MKKIGILITDPEDWTTKSLIEAASSNRINPIPINLADAEVTIGTNITYHAGKINLHDLDA
IIVRDAGGGNGEGVIFRFDILRQLESCGIPVINSPASIQNAANKYHATYLLAEANIPVPP
TKGVQDIENAMNALESFGDAIIKPLFGYKGMGISRIKNGQLILPDGNLDDTPAREFVSRM
MNERKMLYIQKYIANPGRDIRAFVVGDEVIGAIYRKAEKGWLNNLSQGGNTEKCMLEKEQ
EELCIRACEKIGAEYAGVDLIEGKDGNMVLEVNATPSGAGIYRTWGINPAEKIIDHLMER
L
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaataggaatactcataaccgatcctgaagactggaccacaaaatctctaata
gaagccgcgtctagcaaccgcattaatcctatcccgattaatcttgcagatgcagaagtg
actatcgggacaaacataacctatcacgcaggtaaaattaacctgcatgatcttgatgcc
atcattgtgagggatgccggcggaggcaatggggaaggagtcattttcaggtttgacatt
ttacgccagttggaaagctgtgggatacctgttatcaattcaccggcatcaatccagaat
gcagcaaacaaatatcatgctacataccttctggcagaagcaaatataccggtacctcct
acaaaaggtgttcaggatatagaaaatgccatgaatgccctggaatcattcggggatgct
atcatcaagcccttattcgggtataaaggcatgggaatatccagaatcaagaatggacaa
ctaatccttcctgatgggaatttggatgatacaccggcaagggaatttgtgagcaggatg
atgaatgagaggaagatgttatacatccagaaatatatagcaaatcccggcagggacata
cgtgcctttgttgttggggatgaagtaatcggggccatctacagaaaagcggaaaaggga
tggttaaacaatctcagccagggtggaaatactgaaaaatgtatgctggaaaaagagcag
gaagaactctgtatccgtgcatgtgaaaaaataggggccgaatatgcaggagtggacctg
atagaaggaaaagacggtaacatggtgctggaagtcaatgcaactccttccggggcaggt
atttatagaacatggggaataaatccggcagagaagataatagaccaccttatggaaaga
ctctga

DBGET integrated database retrieval system