KEGG   Methanohalophilus mahii: Mmah_1780Help
Entry
Mmah_1780         CDS       T01211                                 

Definition
(GenBank) tetrahydromethanopterin S-methyltransferase, subunit A
  KO
K00577  tetrahydromethanopterin S-methyltransferase subunit A [EC:2.1.1.86]
Organism
mmh  Methanohalophilus mahii
Pathway
mmh00680  Methane metabolism
mmh01100  Metabolic pathways
mmh01120  Microbial metabolism in diverse environments
mmh01200  Carbon metabolism
Module
mmh_M00357  Methanogenesis, acetate => methane
mmh_M00567  Methanogenesis, CO2 => methane
mmh_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mmh00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Mmah_1780
Enzymes [BR:mmh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     Mmah_1780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrA MtrF
Motif
Other DBs
NCBI-ProteinID: ADE37275
UniProt: D5E7Y7
Position
1754521..1755243
Genome map
AA seq 240 aa AA seqDB search
MAEKREPAAGWPILKGEYDVGDPENCVAVITLGSHLDGGPMLEAGASITGPCKTENLGLE
KVVSHIIANPNIRYLVVTGSEVKGHITGEAFIMLHKNGVSDNRIVNASGAIPYVENLTEE
AVQRYQEQIECIDLIGTEDMGTISSKIKELAAKDPDAFDADPLVIEVGGEAEEEEEVGGL
KPMASEISVIRGRILDIEREMARIGEFNKFHAGVHAGKFEGIMIGLAITLSLLGLILFGR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaaaagagaaccagcagccggatggccaatcctcaagggagaatatgatgta
ggagatccggaaaactgtgttgcagtaattactctgggttcacacctggatggcggaccc
atgctggaagcaggagcttcaattacaggcccctgtaaaacagagaatctgggtctggaa
aaagttgtatcccacattattgcaaacccaaatatcaggtatctggtcgtaaccggatct
gaagtaaaaggacacataaccggtgaagcattcattatgctgcacaaaaatggtgtcagt
gataacagaatcgtgaatgccagcggtgctattccatatgtggaaaacctgaccgaagaa
gctgtacagaggtatcaggaacagatcgaatgtatcgatcttatcggtaccgaggacatg
ggaactatcagcagcaagataaaagaacttgcagccaaggaccctgatgcttttgatgca
gatccccttgtgatagaagtcggcggtgaagcagaagaggaagaagaagtcggtggccta
aagccgatggcatccgagatctctgtaattcgtggcaggattcttgatatcgagagggaa
atggccaggattggagagttcaataaattccatgccggtgtccacgcaggcaagtttgaa
ggaataatgatcggacttgccattacattatccctacttggcctgatattattcgggagg
tga

DBGET integrated database retrieval system