KEGG   Mycobacterium marinum M: MMAR_0583
Entry
MMAR_0583         CDS       T00694                                 

Definition
(GenBank) epimerase
  KO
K19974  2-epi-5-epi-valiolone 7-phosphate 2-epimerase [EC:5.1.3.35]
Organism
mmi  Mycobacterium marinum M
Pathway
mmi00525  Acarbose and validamycin biosynthesis
mmi01100  Metabolic pathways
mmi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmi00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00525 Acarbose and validamycin biosynthesis
    MMAR_0583
Enzymes [BR:mmi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.35  2-epi-5-epi-valiolone 7-phosphate 2-epimerase
     MMAR_0583
SSDB
Motif
Pfam: AP_endonuc_2
Other DBs
NCBI-ProteinID: ACC39047
UniProt: B2HP05
Position
686294..687079
AA seq 261 aa
MSRIAVAAPQWRIADCRAAAAAMAIRSGADELQIDFGGAHRGPRLDVPAEQAVVARIARS
IPVTALAVNHANDLGLIDEHGEPNAEAAALLRVALRCAVELGIGVLHVPGFRRSAPDSPQ
RVAGTAAVLRSICQRAERHGIAVAYESALSGAASAALVEAVGHRDLRVVFDIGNLLDFGH
RPGEFVSAVGELLHPDLHVKDPAASRVDVVSELRDVLSSPAPVRSLLVENDYRAIPGRLA
ADVAVCRGLIRSHATRMHSRC
NT seq 786 nt   +upstreamnt  +downstreamnt
atgagccgcatcgcggtggccgcaccccagtggcgcatcgccgattgccgcgcggccgct
gcggccatggcaatccgtagtggcgccgatgaactgcagatcgacttcggtggtgcccat
cgcggcccgcgccttgatgtgcccgcggagcaggccgtcgtcgcgcggatcgctcgcagc
atccccgtcaccgcgctggcggtcaatcacgccaacgatctcggcctcatcgacgagcac
ggggagcccaatgcggaggccgcggcgctgctgcgcgtggcgctgcggtgtgcggtcgag
ctgggcatcggcgttctgcacgttcccggatttcgccgcagcgccccggattccccgcaa
cgggtggccggaactgccgcagtcctgcgctcgatatgccagcgcgccgaacgccacggc
atcgccgtcgcctatgaatccgcgctcagcggagccgccagcgcggccctggtcgaggcg
gtcggtcatcgcgacctgcgggtcgtgttcgatatcgggaacttgctcgactttgggcac
cggccgggcgaattcgtcagcgcggtaggggagttgctgcacccggacctgcatgtcaaa
gacccggccgcgagccgcgttgatgtggtcagcgaactacgcgatgtgctgtcttcaccc
gcgccggtgcggtccttgctggtcgagaacgactaccgcgccataccgggccggctggcc
gccgatgtcgccgtctgccgcggcctgatccgctcgcacgcgactcgtatgcatagccgc
tgctga

DBGET integrated database retrieval system