KEGG   Mycobacterium marinum M: MMAR_2462Help
Entry
MMAR_2462         CDS       T00694                                 

Gene name
argC
Definition
(GenBank) N-acetyl-gamma-glutamyl-phosphate reductase ArgC
  KO
K00145  N-acetyl-gamma-glutamyl-phosphate reductase [EC:1.2.1.38]
Organism
mmi  Mycobacterium marinum M
Pathway
mmi00220  Arginine biosynthesis
mmi01100  Metabolic pathways
mmi01110  Biosynthesis of secondary metabolites
mmi01130  Biosynthesis of antibiotics
mmi01210  2-Oxocarboxylic acid metabolism
mmi01230  Biosynthesis of amino acids
Module
mmi_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:mmi00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    MMAR_2462 (argC)
Enzymes [BR:mmi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.38  N-acetyl-gamma-glutamyl-phosphate reductase
     MMAR_2462 (argC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Semialdhyde_dhC Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: ACC40912
UniProt: B2HR26
Position
2983451..2984503
Genome map
AA seq 350 aa AA seqDB search
MAHATDAIRVAVAGASGYAGGEILRLLLGHPAYTSGRLTIGAVTAAASAGSVLAEHHPHL
LPLAQRILEPTELEVLRGHDVVFLALPHGHSAALADQLGPETLIIDCGADFRLTDAAAWE
RFYGSAHSGSWPYGLPELPGARERLRDTRRIAVPGCYPTAALLALLPAVAEGLIDPAVTV
VAVSGTSGAGRAAKTDLLGSEVIGSARAYNIAGAHRHTPEIAQGLRAVTDRDVTVSFTPV
LIPTSRGILATCTARTRSPIARLRSAYEKAYEAEPFIYLMPEGQLPRTGAVIGSNAAHIA
VAVDEEAETFVAIAAIDNLVKGTAGAAVQSMNLALGWPETEGLSVVGVAP
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggcccatgcgaccgatgcaatcagggtggccgtagcaggtgccagcggctatgcaggc
ggtgagatccttcgccttctgctggggcatcccgcctacacctcgggacggctgacgatc
ggggcggtgaccgcagcggccagcgcgggaagcgtcctcgcggagcaccatccgcatctg
ttgccgctggcccagcggatcctcgagcccaccgagctcgaggtgctccgcggacatgac
gtggtattcctcgctttgccgcacgggcattcggcggcgctggccgatcaactcggccca
gaaactctgatcatcgactgtggggccgattttcggctcaccgatgcggcggcttgggag
cggttctatgggtcagcgcattccggcagctggccctacggactacccgaattgccgggt
gctcgggagcggttgcgtgacacccgccgcatagcggttccgggttgctacccgaccgcg
gcgctgctcgcactgctgcccgcggtggccgagggcctcatcgatccggccgtgacggtg
gtcgccgttagcggtacctcgggggctggccgggccgccaagaccgacctgctcggctcg
gaagtcatcgggtcggcccgggcctacaacatcgcgggtgcgcaccggcatactcccgag
atcgcacaaggcttgcgcgcggtcaccgaccgagacgtcaccgtttcgtttacaccggtt
cttatcccgacctcacgtggaattctggcaacctgtaccgcgcgtacccgctcgccaatc
gctcggttacggtcagcctacgaaaaagcttatgaggcagaaccttttatctatttgatg
ccggagggtcagttgccccgcactggtgccgtgattggcagcaacgcggcgcacatagcg
gtcgctgtggatgaagaagccgagacctttgttgcgattgccgcaatcgacaacctggtc
aagggcactgccggggccgccgtgcagtcgatgaacctggcgctgggctggccggagaca
gaagggctctcagtggtcggggtggcgccatga

DBGET integrated database retrieval system