KEGG   Mycobacterium marinum M: MMAR_2746Help
Entry
MMAR_2746         CDS       T00694                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mmi  Mycobacterium marinum M
Pathway
mmi00071  Fatty acid degradation
mmi00072  Synthesis and degradation of ketone bodies
mmi00280  Valine, leucine and isoleucine degradation
mmi00310  Lysine degradation
mmi00362  Benzoate degradation
mmi00380  Tryptophan metabolism
mmi00620  Pyruvate metabolism
mmi00630  Glyoxylate and dicarboxylate metabolism
mmi00640  Propanoate metabolism
mmi00650  Butanoate metabolism
mmi00900  Terpenoid backbone biosynthesis
mmi01100  Metabolic pathways
mmi01110  Biosynthesis of secondary metabolites
mmi01120  Microbial metabolism in diverse environments
mmi01130  Biosynthesis of antibiotics
mmi01200  Carbon metabolism
mmi01212  Fatty acid metabolism
mmi02020  Two-component system
Module
mmi_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mmi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MMAR_2746
   00630 Glyoxylate and dicarboxylate metabolism
    MMAR_2746
   00640 Propanoate metabolism
    MMAR_2746
   00650 Butanoate metabolism
    MMAR_2746
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MMAR_2746
   00072 Synthesis and degradation of ketone bodies
    MMAR_2746
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MMAR_2746
   00310 Lysine degradation
    MMAR_2746
   00380 Tryptophan metabolism
    MMAR_2746
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MMAR_2746
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MMAR_2746
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MMAR_2746
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmi04147]
    MMAR_2746
Enzymes [BR:mmi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MMAR_2746
Exosome [BR:mmi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MMAR_2746
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C
Motif
Other DBs
NCBI-ProteinID: ACC41188
UniProt: B2HD51
Position
3348408..3349892
Genome map
AA seq 494 aa AA seqDB search
MVVDPRTPVLIGYGQVNYRDEIDPTMPSVEPVDLMLAAAQQAADSRVLAAVDSIRVVRVL
SAHYRNPGQLLGERLQASGFTTSYSSVGGNTPQSLVSQACLDVQRGRAGVVLIAGAETWR
TRTGLKSKGARLTWTLQDESVPLPRVAGQDVPMAGESEIRIKLDRPAYVYPIFEQALRIA
NGESIEDHRSRVGRLWAGFNAVAVDNPHAWIRTPMTAEQICRPGPQNRMISWPYTKLMNS
NNMVDQGAALILTSVEQATRLRVPTERWVYPQTGTEAHDTFSIAERAELHQSPAIRIAGA
RALELAGLGIDDADYVDLYSCFPSAVQVAAHELGLPVDDADRPLTVTGGLTFAGGPWNNY
VTHSIATMAELLAANPGRRGLITANGGYLTKHSIGVYGTEPPAEFCWEDVQPLVDREPTR
AALVGWDGVGAVEAWTTPFTRDGQPEKAFVAVRTPTGARTLGVITDPASANATVHEDIAG
AKVAIAADGNATLR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggtcgtagacccccgcacgccggtgctgatcggctacggccaggtcaactaccgcgat
gaaatcgaccccaccatgccgtcggtcgagcctgtcgatctgatgctcgccgcggcgcag
caggcggccgattcccgggtgctcgcggccgttgactccattcgcgtggtccgcgtgctc
tcggcgcactaccgcaatcccggccagttgctcggcgagcggctgcaggccagtggtttc
accaccagctacagcagcgtcggcggcaacacaccgcagtctctggtcagccaggcgtgc
ctggacgtacagcggggtcgagccggggtggtgttgatcgccggcgccgagacgtggcgg
accaggaccggtctgaagtccaagggcgcccgactgacctggacgcttcaggacgaatcc
gttccgctgccgcgggtcgccggccaggatgtgccgatggccggcgagagcgaaatcaga
atcaagctggatcggcccgcctacgtctatccgatattcgagcaggcgctacgcatcgcc
aacggcgagtcaatcgaggaccaccgcagcagagtcggccgactgtgggcggggttcaac
gcggtcgcggtggataacccgcacgcctggatccgcaccccgatgaccgccgaacagatt
tgtcggcccggcccgcagaaccggatgatcagctggccctacaccaagctgatgaactcc
aacaacatggttgaccagggcgccgccctgatcctcacgtcggtcgagcaggcgacacgg
ctgcgggtgcccaccgaacgctgggtctacccgcagaccgggaccgaggcgcacgacacc
ttctcgattgccgagcgcgccgagctgcaccagtcgccggccatccgaattgccggggca
cgcgcgttggaactcgccggtctgggcatcgacgatgccgactacgtcgacctgtactcg
tgtttcccgtccgcggtgcaggttgccgcacacgaactcgggctgcccgtcgacgatgcc
gaccggccgttgaccgtcaccggcggactgacctttgccgggggcccgtggaacaactac
gtcacacattcgattgccaccatggccgagttattggcggccaaccccggccggcgcggg
ctgatcaccgccaacggcggctacctgaccaagcacagcatcggcgtgtacggcaccgag
ccacccgcggagttctgctgggaagacgtgcaaccgctggtggaccgcgagcccacccgg
gccgccctggtcggatgggacggcgtcggagccgtcgaggcctggacaacgcccttcacc
agagacgggcaacccgagaaggccttcgtcgccgtgcgcacgcccaccggggcgcgtacc
ttaggcgtgatcaccgatcccgcatcggccaatgccaccgtgcatgaggacatcgccggg
gcaaaggttgccatcgctgccgatggcaacgcgacattgcggtaa

DBGET integrated database retrieval system