KEGG   Mycobacterium marinum M: MMAR_4754
Entry
MMAR_4754         CDS       T00694                                 

Definition
(GenBank) short-chain type dehydrogenase/reductase
  KO
K12466  (+)-trans-carveol dehydrogenase [EC:1.1.1.275]
Organism
mmi  Mycobacterium marinum M
Pathway
mmi00903  Limonene and pinene degradation
mmi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmi00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MMAR_4754
Enzymes [BR:mmi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.275  (+)-trans-carveol dehydrogenase
     MMAR_4754
SSDB
Motif
Pfam: adh_short_C2 adh_short KR
Other DBs
NCBI-ProteinID: ACC43158
UniProt: B2HG46
Position
5804903..5805754
AA seq 283 aa
MTEQLGGRVAGKVAFITGAARGQGRSHAVRLAQEGADIIAVDVCKPIVENTTIPASTPED
LAETADLVKGHNRRIFTAEADVRDYDALKAAVDAGVDELGRLDIIVANAGIGNGGATLDK
TSEHDWQEMIDVNLSGVWKSVKAAVPHLIAGGNGGSIVLTSSVGGMKAYPHCGNYVAAKH
GVVGLMRSFAVELGQHMIRVNSVHPTHVRTPMLHNEGTFKMFRPDLENPGPDDMAPICQL
FHTLPIPWVEAEDISNAVLFLASDESRYITGVTLPVDAGGCLK
NT seq 852 nt   +upstreamnt  +downstreamnt
atgactgagcagcttggcgggcgggtcgcgggaaaagtcgcgttcatcaccggagcggct
cgcggccagggccgcagccacgcggtacgtctggcgcaggagggtgccgacatcatcgct
gtcgacgtgtgtaaacccatcgtggagaacaccaccatcccggcgtccaccccggaggac
ctggccgagacggccgatctggtcaagggacacaaccgccggatcttcaccgccgaggcc
gatgtgcgtgactacgacgcgctgaaagccgcggtggacgccggagtggacgaactgggc
cggctggacatcatcgtggccaacgcgggcatcggcaacggtggcgccacgctggacaag
accagtgaacacgactggcaggagatgatcgacgtcaacctgtccggggtctggaaatcc
gtcaaagccgcggtgccgcatctgattgccgggggcaacgggggctcgatcgtcttgacc
agttcggtcggcggaatgaaggcgtacccgcactgcggcaattacgtggcggccaaacac
ggcgtcgtaggcctgatgcggtcctttgcagttgagttggggcaacacatgattcgggtc
aattcggtacacccaacgcatgtccggacccccatgctgcacaacgagggcaccttcaag
atgtttcgcccggacctggagaatcccggtcccgacgacatggcaccgatctgccagctc
ttccacaccctgccgattccgtgggtcgaggccgaagacatcagcaacgccgtgctgttc
ctggcctccgacgagtcccgctacataaccggtgtcaccctgcccgtcgacgcaggtggc
tgcctgaaatag

DBGET integrated database retrieval system