KEGG   Mycobacterium marinum M: MMAR_5213Help
Entry
MMAR_5213         CDS       T00694                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K07008  gamma-glutamyl hercynylcysteine S-oxide hydrolase [EC:3.5.1.118]
Organism
mmi  Mycobacterium marinum M
Pathway
mmi00340  Histidine metabolism
mmi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    MMAR_5213
Enzymes [BR:mmi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.118  gamma-glutamyl hercynylcysteine S-oxide hydrolase
     MMAR_5213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_6 GATase_4 Peptidase_M13_N
Motif
Other DBs
NCBI-ProteinID: ACC43618
UniProt: B2HKC1
Position
complement(6298563..6299276)
Genome map
AA seq 237 aa AA seqDB search
MCRHLGWLGSEVTLSSLILDPPYGLRVQSYAPRRQKHCLMNADGWGAGFFDSRDDDPAPR
RWRSPAPLWGDASFDSVAPALRSSCVVAAVRSATVGMPIDISATAPFTDGRWLLSHNGIV
DRAVLPRSDSAESVCDSALLAAAIFERGLDALGDTIREIGAADPGARLNVLAANGSRLLA
TTWNETLSILRRPDGVVVASEPYDNDTDWEDVPDRHLVEVTAEGVTLTALEPTKGTR
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcgtcatctcggttggctcggcagcgaggtcacgctttcctcgctgatcctggat
ccgccttacggtctgcgggtgcagtcgtatgcgccgcgccgccagaaacactgcctgatg
aacgccgacggctggggtgccggcttcttcgacagccgtgacgacgaccccgcaccccgg
cgctggcgtagcccggctccgctgtggggtgatgcgtcctttgattcggtggcgccggca
ttgcgcagctcgtgcgtggtggccgcggtgcgttccgcaaccgtcggaatgccaatcgac
atcagcgcgaccgccccattcaccgacggccgctggctgttgtcgcacaacggtatcgtc
gaccgggccgtgttaccgcgcagcgactcagccgaatcggtatgtgacagcgcattgctc
gcggcggccatcttcgagcgcggtctggatgcgctgggcgacacgatccgcgagatcggg
gccgccgatccaggtgcccggcttaatgtgctggccgcgaacgggtctcgcttgcttgcc
actacctggaacgaaaccctttccatcctgcgtcgccccgatggggtggtggtggccagt
gagccctatgacaacgacaccgactgggaagatgtgccggaccggcacctggtcgaggtc
accgcggaaggggttaccttgaccgcattggagcccacgaaaggaacgcgatga

DBGET integrated database retrieval system