KEGG   Mycobacterium tuberculosis variant microti: RN08_0269Help
Entry
RN08_0269         CDS       T04291                                 

Definition
(GenBank) lipoprotein LpqI
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mmic  Mycobacterium tuberculosis variant microti
Pathway
mmic00520  Amino sugar and nucleotide sugar metabolism
mmic01100  Metabolic pathways
mmic01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:mmic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RN08_0269
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    RN08_0269
Enzymes [BR:mmic01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     RN08_0269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: AMC57696
UniProt: A0A109SKA5
Structure
PDB: 

Position
285906..287072
Genome map
AA seq 388 aa AA seqDB search
MAFPRTLAILAAAAALVVACSHGGTPTGSSTTSGASPATPVAVPVPRSCAEPAGIPALLS
PRDKLAQLLVVGVRDAADAQAVVTNYHVGGILIGSDTDLTIFDGALAEIVAGGGPLPLAV
SVDEEGGRVSRLRSLIGGTGPSARELAQTRTVQQVRDLARDRGRQMRKLGITIDFAPVVD
VTDAPDDTVIGDRSFGSDPATVTAYAGAYAQGLRDAGVLPVLKHFPGHGRGSGDSHNGGV
TTPPLDDLVGDDLVPYRTLVTQAPVGVMVGHLQVPGLTGSEPASLSKAAVNLLRTGTGYG
APPFDGPVFSDDLSGMAAISDRFGVSEAVLRTLQAGADIALWVTTKEVPAVLDRLEQALR
AGELPMSAVDRSVVRVATMKGPNPGCGR
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggcttttccacgcacactggcgatactcgctgcggcagcagcgttggtggtggcctgc
agccatggcggcacacccaccggatcgtcgacgacctccggcgcgtcgcccgcaactccg
gtagccgttcccgtgccccggagctgcgccgagccggcggggatcccggcgctgctgtcc
ccccgtgacaagctggcccagctgctggtggtcggcgtgcgagatgctgcggacgcccaa
gccgtggtcaccaactaccacgtcggcggcatcctcatcggcagcgacaccgacctgacg
atttttgacggcgcgctggccgagatcgttgccggcgggggtccgctgccgctggcggtg
agtgtcgacgaggaaggcgggcgggtgtcccggttgaggtcgctgatcggcggtacgggg
ccgtcggcccgcgaactggcacaaacccgaaccgtccagcaggtgcgcgacttggctcga
gaccgcggccggcagatgagaaagctgggtatcaccatcgacttcgccccggtggtcgac
gtcaccgacgccccggatgacacggtgatcggggaccggtcgttcggctcggatccggct
acggtcaccgcgtatgccggggcgtacgcgcagggtctgcgcgatgccggggtgctgccg
gtgctcaagcatttccccggtcacgggcgtggctcgggtgattcgcacaacgggggtgtc
acgacaccaccgcttgatgacctggtgggcgatgacctggtgccctaccgaacgctggtg
acccaggcgccggtcggtgtgatggtgggtcatctgcaggttcctgggttgaccggctcc
gagccggccagtctgagcaaggccgcggtgaacctgctgcgcaccggcacgggatacggc
gcaccgccgttcgatggtccagtgttcagcgacgacctctctggtatggccgcgatctca
gaccggtttggcgtcagcgaggcggtgttgcgcaccttgcaagccggtgccgatatcgca
ctgtgggttaccaccaaagaggtgcccgcggtgctggaccgcctggaacaggcgctgcgc
gccggtgaattgccgatgtcggcggtcgaccggtcggtggtgcgggtggcgaccatgaag
gggcccaacccggggtgtggccgttag

DBGET integrated database retrieval system