KEGG   Mycobacterium microti: RN08_2072Help
Entry
RN08_2072         CDS       T04291                                 

Definition
(GenBank) hypothetical protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mmic  Mycobacterium microti
Pathway
mmic00071  Fatty acid degradation
mmic00072  Synthesis and degradation of ketone bodies
mmic00280  Valine, leucine and isoleucine degradation
mmic00310  Lysine degradation
mmic00362  Benzoate degradation
mmic00380  Tryptophan metabolism
mmic00620  Pyruvate metabolism
mmic00630  Glyoxylate and dicarboxylate metabolism
mmic00640  Propanoate metabolism
mmic00650  Butanoate metabolism
mmic00900  Terpenoid backbone biosynthesis
mmic01100  Metabolic pathways
mmic01110  Biosynthesis of secondary metabolites
mmic01120  Microbial metabolism in diverse environments
mmic01130  Biosynthesis of antibiotics
mmic01200  Carbon metabolism
mmic01212  Fatty acid metabolism
mmic02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mmic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RN08_2072
   00630 Glyoxylate and dicarboxylate metabolism
    RN08_2072
   00640 Propanoate metabolism
    RN08_2072
   00650 Butanoate metabolism
    RN08_2072
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RN08_2072
   00072 Synthesis and degradation of ketone bodies
    RN08_2072
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RN08_2072
   00310 Lysine degradation
    RN08_2072
   00380 Tryptophan metabolism
    RN08_2072
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RN08_2072
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RN08_2072
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RN08_2072
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmic04147]
    RN08_2072
Enzymes [BR:mmic01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RN08_2072
Exosome [BR:mmic04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RN08_2072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AMC59499
UniProt: A0A120IWZ3
Position
2119708..2121168
Genome map
AA seq 486 aa AA seqDB search
MLIGYGQVNHRGDIDAEKQSIEPVDLMAAAARKAADSTVLEAVDSIRVVHMLSAHYRNPG
QLLGERIKARTFTTGYSGVGGNMPQSLVNRACLDIQRGRAGVVLLAGAETWRTRTGLRAK
GSKLEWTVQDESVPLPDMAGDDVPMAGAAELRINLDRPAYVYPIFEQALRIAYGESIENH
RKRIGELWARFSAVAADNPHAWIRNPVTADEIWQPGPQNRMVSWPYTKLMNSNNMVDQGA
ALLLTSVERATRLRIPAERWVYPQAGTDAHDTPAVADRHRLHRSTAIRIAGARALELAGL
GLDDIEYVDLYSCFPSAVQVAAIELGLDTDDPARPLTVTGGLTFAGGPWSNYVTHSIATM
AELLAANPGRRGLITANGGYLTKHSFGVYGTEPPSEFRWEDMQPAVDREPTGDGLVEWEG
IGTVEAWTTPVNRDGQPEKAFLAVRTPDGSRSLAVITDPASVQATVREDIAGVKVAVAPD
GTATLR
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
gtgctgatcggctatggacaggtcaaccaccgaggcgacatcgacgccgagaagcagtcc
atcgaacccgtcgacctgatggccgccgcggcccggaaagccgcggattcgacggtgctc
gaggcggtggattcgatccgtgtggtgcacatgctgtcggcgcattaccggaatcccggg
cagctcctcggcgaacgaatcaaggcgaggaccttcaccaccggttacagcggggtgggc
ggcaacatgccgcaatccctggtcaaccgggcatgcctggacatccagcgcgggcgggcc
ggcgtggtgctgctggctggcgccgaaacctggcgcacccgaacgggcctgcgcgccaag
ggcagcaaactggagtggactgtgcaggacgaatccgttccgctgccggacatggccggc
gacgacgttccgatggccggtgcggctgagctgcggatcaacctggaccggccggcctac
gtgtacccgatattcgagcaggcgctgcgcatcgcctacggcgagtcgatcgagaaccac
cgaaagcggatcggcgagctgtgggcgcggttcagtgccgtagctgctgacaacccgcac
gcgtggatccgcaacccggttacggctgacgagatctggcagcccggcccacagaaccgg
atggtcagctggccctacaccaagcttatgaactccaacaacatggttgaccagggtgcc
gcgctgctgctgacgtcggtcgaacgtgcgacacgtctgcgaataccggccgaacgctgg
gtttatccacaggctggcaccgacgcccacgacacaccggccgtcgccgaccgccaccga
ctgcatcggtcgacggccattcggatcgccggtgcccgggcgctggaactggctgggctg
gggctcgatgacatcgaatacgtcgacctgtattcgtgctttccctccgctgtccaagtc
gccgcaatcgaactcggcctggacaccgacgatcctgcccgcccgctgaccgtcaccggg
ggcctgaccttcgccggcgggccgtggagcaattacgtcacgcactccatcgccaccatg
gctgaactgctggcggccaatcccgggcgccgaggtctgatcaccgccaacggcggttac
ctgaccaaacacagtttcggggtctacggcaccgagccgccgtcggaattccgctgggag
gacatgcaacccgcggtcgatagggagcccaccggagatgggttggtcgagtgggaaggc
atcggcaccgtcgaagcgtggaccacaccagtcaaccgggacggacaacccgagaaggcg
ttcctggcggtgcgcacgcccgacgggtcgcgcagcttggccgtgatcaccgatcccgca
tcggtgcaagcaacggtgcgcgaggacatcgccggcgtcaaggttgccgtcgcccccgac
ggcaccgcgaccctgcgatag

DBGET integrated database retrieval system