KEGG   Mycobacterium tuberculosis variant microti: RN08_2713Help
Entry
RN08_2713         CDS       T04291                                 

Definition
(GenBank) nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
mmic  Mycobacterium tuberculosis variant microti
Pathway
mmic00230  Purine metabolism
mmic00240  Pyrimidine metabolism
mmic00983  Drug metabolism - other enzymes
mmic01100  Metabolic pathways
mmic01110  Biosynthesis of secondary metabolites
mmic01130  Biosynthesis of antibiotics
Module
mmic_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
mmic_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
mmic_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:mmic00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    RN08_2713
   00240 Pyrimidine metabolism
    RN08_2713
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    RN08_2713
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmic04131]
    RN08_2713
Enzymes [BR:mmic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     RN08_2713
Membrane trafficking [BR:mmic04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    RN08_2713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK TruB_C
Motif
Other DBs
NCBI-ProteinID: AMC60140
Structure
PDB: 

Position
complement(2739314..2739736)
Genome map
AA seq 140 aa AA seqDB search
MLGTVTERTLVLIKPDGIERQLIGEIISRIERKGLTIAALQLRTVSAELASQHYAEHEGK
PFFGSLLEFITSGPVVAAIVEGTRAIAAVRQLAGGTDPVQAAAPGTIRGDFALETQFNLV
HGSDSAESAQREIALWFPGA
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
gtgttgggcaccgtgaccgaacggactctggtactgatcaagccggatggcatcgaaagg
cagctgatcggcgagatcatcagccgcatcgagcgcaaaggcctcaccatcgctgcgctg
cagctcaggaccgtcagcgcggagttggccagccagcactacgccgaacatgaaggcaaa
ccattctttggatcgttgctggagttcatcacgtcgggtccggtggtagcggcgatcgtg
gagggaacccgagccatcgcggcggttcgccaactcgccggcggcaccgacccggtgcag
gcggcggcgcccggcacaatccggggcgacttcgctctagagacgcagttcaacctggtg
cacgggtctgattcggccgaatccgcgcagcgcgaaatcgcgctctggtttcccggcgcc
tag

DBGET integrated database retrieval system