KEGG   Methanobrevibacter millerae: sm9_0688Help
Entry
sm9_0688          CDS       T04203                                 

Gene name
gpxA
Definition
(GenBank) glutathione peroxidase GpxA
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mmil  Methanobrevibacter millerae
Pathway
mmil00480  Glutathione metabolism
mmil00590  Arachidonic acid metabolism
mmil01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmil00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    sm9_0688 (gpxA)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    sm9_0688 (gpxA)
Enzymes [BR:mmil01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     sm9_0688 (gpxA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ALT68485
UniProt: A0A0U2SHP1
Position
798254..798793
Genome map
AA seq 179 aa AA seqDB search
MSIYDFEVKDGEGNMVSLKEYEGKVLLIVNSATKCGFTPQYTELNEIYAEFNEQGFEILD
FPCNQFGSQAPGSTEEITEVCRNKWLVPYSIFEKIDVNGENADPLFEYLKNEQPFTEITG
KGATKLKLVLKAIDRHYKDNNDIKWNFTKFLVDREGNVVRRFEPTEDLGDVKSSIKDLL
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatttatgattttgaagtaaaagatggtgaaggaaacatggtttccttaaaagaa
tacgaaggaaaagtattgttgattgttaattcagcaacaaaatgtggttttactccacaa
tacacggaattaaatgaaatttatgctgaattcaatgaacagggttttgaaatcttggat
ttcccatgcaatcagtttggaagtcaagctccaggttcaactgaagaaatcactgaagtt
tgccgtaacaaatggttagtgccttattcaatctttgaaaaaattgatgtaaatggtgaa
aatgcagatccattatttgaatatcttaaaaacgaacagccatttactgaaattactgga
aaaggtgcaacaaaacttaaattagttttaaaagcaatagacagacattataaagataat
aacgacattaaatggaacttcactaaatttttagttgaccgagagggtaatgttgttcga
agattcgaaccgactgaagatttgggtgatgtaaaatcatctattaaagatttattataa

DBGET integrated database retrieval system