KEGG   Methanobrevibacter millerae: sm9_1930Help
Entry
sm9_1930          CDS       T04203                                 

Gene name
cysG
Definition
(GenBank) siroheme synthase CysG
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
mmil  Methanobrevibacter millerae
Pathway
mmil00860  Porphyrin and chlorophyll metabolism
mmil01100  Metabolic pathways
mmil01110  Biosynthesis of secondary metabolites
mmil01120  Microbial metabolism in diverse environments
Module
mmil_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mmil00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    sm9_1930 (cysG)
Enzymes [BR:mmil01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     sm9_1930 (cysG)
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     sm9_1930 (cysG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 Sirohm_synth_M F420_oxidored 2-Hacid_dh_C Rossmann-like Endopep_inhib Shikimate_DH IlvN CysG_dimeriser ABC2_membrane_3
Motif
Other DBs
NCBI-ProteinID: ALT69696
UniProt: A0A0U3E9Q2
Position
complement(2117647..2118276)
Genome map
AA seq 209 aa AA seqDB search
MDWTALYLKTSALKVFILGTGEVATRRANKFLNHGAIVKLAGNSINEELSKNGAELYSTD
DVDDLVDWSDLVVIASGDRKLSDYVADISKDKLVNRADFPDNGDIIVPTSFNIGDIEISI
FTNGKSPLMAKQLRKRIQSIITEDDILEIELQDYSRSLLKEYVSNQKDRRDYLYEIFENE
EIQELIKSRKIDEAKSVIFELIQGDFDDT
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggattggactgctctttatttaaaaacttcagctttgaaagtatttattttaggtact
ggtgaagttgcaaccagaagagcaaataaatttttaaatcatggggcaattgtaaaactt
gcaggtaattcaatcaatgaagaactgtccaaaaatggggctgaattatattccactgat
gatgtggatgatttggttgattggtcagatttggttgtaatagcaagcggtgatagaaaa
ttgtctgattatgttgcagatatatctaaagataaattagtaaatcgtgctgattttccg
gataatggggatataattgttccaacaagttttaatattggagatattgaaatttctatt
tttaccaatggcaaaagtccattgatggcaaaacaactaagaaaaagaatacaatcaatc
atcactgaagatgatattttagaaattgaactgcaggattattcacgttcacttttaaag
gaatatgtttccaatcaaaaggacagacgggattatttatatgaaatttttgaaaatgaa
gagattcaggaattaattaaatctagaaaaattgatgaagcaaaatcagttatttttgag
ttaatacagggggattttgatgatacttaa

DBGET integrated database retrieval system