KEGG   Mycolicibacter minnesotensis: MMIN_37820
Entry
MMIN_37820        CDS       T06638                                 

Definition
(GenBank) oxidoreductase
  KO
K12466  (+)-trans-carveol dehydrogenase [EC:1.1.1.275]
Organism
mmin  Mycolicibacter minnesotensis
Pathway
mmin00903  Limonene and pinene degradation
mmin01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmin00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MMIN_37820
Enzymes [BR:mmin01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.275  (+)-trans-carveol dehydrogenase
     MMIN_37820
SSDB
Motif
Pfam: adh_short_C2 adh_short KR DUF1776
Other DBs
NCBI-ProteinID: BBY35721
Position
4053010..4053855
AA seq 281 aa
MYDNRIGRVAGKVAFITGAARGQGREHAIRLAEEGADIIAVDVCADIDGVAYPGATEDDL
ADTAALVEKAGRRIVTAKADVRDLDSLRVALERGVATLGALDIVVANAGISGSPAQAALI
EQSAWQTMLDINLTGVWLTVKAALPHMTNGGGSIILISSMLGLRGGGYMAHYASAKHAVV
GLMNSLANELAPQSIRVNSIHPGNVLTPMIDNDQFHRTLRPDLAEPTMADTAAIIGHFHM
LPKPVIEARAVSNAVLFLASDEAQYITGAALPVDAGAVAKF
NT seq 846 nt   +upstreamnt  +downstreamnt
atgtacgacaataggatcggcagagtcgccggcaaggtcgcgttcatcaccggcgcagcc
cgtggccagggtcgcgaacacgcaattcgactggccgaggaaggcgctgacatcatcgcg
gtcgatgtctgcgcagacatcgacggtgtcgcttatccgggtgcgacggaggatgacctc
gccgacaccgcggccctggtggagaaggcgggccgccgcatcgtcaccgccaaggccgac
gtgcgcgacctggacagcctgcgcgtcgcccttgagcggggtgtggccaccttgggcgca
ctggacatcgtggtagcgaacgccggcatcagcggttcaccggcgcaggctgcgctgatc
gaacagtccgcatggcagaccatgctggatatcaacctgaccggggtgtggctcacagtc
aaagcggcactgccacatatgaccaacggcggcggatcgatcatcttgatcagctcgatg
ttgggccttcgcggcggcggctacatggcccactatgcgtcggccaaacatgccgtcgtc
gggttgatgaattcgctcgcgaatgagcttgcgccgcaatcgatcagggttaactcaatc
catcctggcaacgtcttgacaccgatgatcgacaacgaccagttccaccggactctgcgc
ccagacctggccgaaccaaccatggccgacaccgcggcgatcatcgggcacttccacatg
ctgcccaagccggtgatcgaggcacgcgccgtcagtaacgccgtgctcttcctcgcctcc
gatgaggcgcagtacatcaccggagcggcgctaccggtcgacgccggcgccgttgcgaag
ttctga

DBGET integrated database retrieval system