KEGG   Morganella morganii: MU9_1084
Entry
MU9_1084          CDS       T02496                                 

Definition
(GenBank) Xanthine dehydrogenase iron-sulfur subunit
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
mmk  Morganella morganii
Pathway
mmk00230  Purine metabolism
mmk01100  Metabolic pathways
mmk01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mmk00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    MU9_1084
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: AGG30130
UniProt: J7TEM7
Position
complement(1220393..1220872)
AA seq 159 aa
MNIKEWKTISCTLNGQVRELTVSPAARLSDVLREQGLISVKHGCSVGECGACTVLIDGIA
VDTCLYLAVWADGKQIRTAEGEMKHGKPSAVQQAYADSGAVQCGFCTPGLIMMTTALLEK
HKGQTLTIRQIRHGLAGNLCRCTGYQMVANAADKLQRNQ
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatatcaaagaatggaaaaccatcagctgcacactcaacggacaggtacgggaactg
acggtgtcaccggcggcacggctgtccgatgtcctgcgtgagcaggggcttatcagtgtc
aaacatggctgctctgtcggtgagtgcggtgcctgcacggtacttatcgacggtatcgcg
gtggatacctgtctctatctggcggtctgggcggacggtaagcagatccgaaccgccgaa
ggtgagatgaagcacggtaaaccgtctgcggtacagcaggcttatgcggacagcggcgcg
gtacagtgcgggttctgcaccccgggcctgattatgatgaccaccgccctgctggaaaaa
cacaaagggcagacccttaccatccgtcagatccgccacggcctggccggtaacctgtgc
cgctgcaccggttatcagatggttgccaatgccgcggataaactccagcgtaatcagtaa

DBGET integrated database retrieval system