KEGG   Morganella morganii: MU9_1086
Entry
MU9_1086          CDS       T02496                                 

Definition
(GenBank) Xanthine dehydrogenase, molybdenum binding subunit
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
mmk  Morganella morganii
Pathway
mmk00230  Purine metabolism
mmk01100  Metabolic pathways
mmk01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mmk00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    MU9_1086
Enzymes [BR:mmk01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     MU9_1086
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: AGG30132
UniProt: J7U8N2
Position
complement(1221753..1224059)
AA seq 768 aa
MSEAVGKRALGTPYLRVDALSKTSGRARYTDDLPMPGMHYAKYVRSTIAHGMVTSVDASQ
ALAMPGVVAVFTCNDVPQIPFATAGHAWSLEPAKRDVADRLLLNRHVRHHGDGVAIVVAR
DELTAEKAAALVSVTYDELPVITSPEAALAADAPQIHSCGNLLKRTAINAESARATVSQS
PFQFRGHFDTPVVQHCHMEGVTCYAWQEADNKISVVSSTQIPHIVRRVIGQALDMPWSHI
RVIKPYIGGGFGNKQDVLEEPMAAWLTLKLGGIPVKVELSREECFFASRTRHAFHIDAEM
GLTADGTLNGYHLDVLSNTGGYASHGHSIAAAGGNKIPYLYPRCDYGYSAATVYTNYPSA
GAMRGYGAPQVTFALECLMDDAAAQLNIDPVDIRLRNAARSGDCNPVNKKTIYSAGLIEC
LKRGKELFGWDERKAEALATRGDIRRGVGVACFSYSSNTYPVGVEIASARLLMNQDGNIN
VQVGATEIGQGSDTVFSQMVAETLGVPVSTIQMISTQDTDITPFDPGAFASRQSYVTAPA
LKEAALSLRQKILDHASLMTHQAAFNMTILDGNVVLEAQPDVVVTTVAEVAMHSFYHQEI
GGQLSAESSHKTQTNPPAFGCTFVDVTVDIPMCQVTINRIINMHDSGRILNPQLAEGQVH
GGMGMGIGWALFEEMLINEKSGVVHNPNLLDYKMPTMVDLPDLECGFVETYEPQSAYGHK
SLGEPPIIAPAAAIRNAVRMATGISVNTIPLTPKRLYREFVNAGLIRG
NT seq 2307 nt   +upstreamnt  +downstreamnt
atgtctgaagcagtcggaaaacgcgcgctgggtacgccttacctgcgcgttgatgccctg
agcaaaacatcagggcgggcgcgctacacggatgatctgccgatgccgggtatgcactac
gccaaatatgtccgcagtaccattgcccacgggatggtaacatccgttgatgcgtcacag
gcgctcgccatgccgggtgtggtcgcggtattcacctgtaacgatgtgccgcagatcccg
ttcgccaccgccggtcacgcctggtctctggaaccggccaaacgtgatgtggcagaccgc
ctgctgctgaaccgccatgtgcgccaccacggcgacggtgtggcgattgtggttgcccgt
gacgaactgactgccgaaaaagcggcggcactcgtcagcgtcacttatgacgagctgccg
gttatcacctcaccggaggcggcactggccgcagatgccccgcaaatccacagctgcggt
aacctgctgaaacgtaccgctatcaatgcggaaagcgccagagcgacagtcagtcagtcg
ccgttccagttccgcggccattttgataccccggtggttcagcattgccatatggaaggc
gtcacctgctacgcctggcaggaggcggataataagatttccgtggtatcgagtacccag
atcccgcacattgtgcgccgtgtgataggccaggcgctggatatgccgtggtcgcatatc
cgggtgattaagccgtatatcggcggcggtttcggtaataaacaggacgtgctggaagag
ccgatggccgcctggctgaccctgaaactcggcggtattccggtgaaagtggagctgagc
cgcgaagagtgtttctttgcctcgcgcacccgtcacgccttccatattgatgcggagatg
ggactgaccgccgacggcacactgaacggttatcatcttgatgttctgtccaataccggc
ggctatgcctctcacggacactccattgcggctgcgggcgggaacaaaatcccgtacctg
tatccgcgctgcgattacggctattccgccgccaccgtctataccaactacccgtcagcg
ggcgcaatgcgcggctacggagcaccacaggtcacgttcgccctcgaatgcctgatggat
gatgccgccgcacagctgaatatcgacccggtggatatccgtctgcgtaatgcggcgcgg
tccggtgactgtaacccggtcaataagaaaacgatttacagtgcggggctgattgagtgc
ctgaaacgcggtaaagagctgttcggctgggatgaacgcaaagcagaggcgctggcaaca
cgcggagacatccgccggggcgtcggtgtagcctgtttcagttattcatccaatacctat
ccggtcggcgtggaaatcgccagtgcccgtctgctgatgaaccaggacggtaatatcaat
gtgcaggtcggcgcgacagaaatcggccagggctcggataccgtgttctcgcagatggtg
gcggaaaccctcggcgtgccggtcagtaccattcagatgatctccacccaggatacggat
atcaccccgtttgacccgggcgcgttcgcgtcacggcagagttatgtcaccgcaccggcg
ctgaaagaagcggcattgtcactgcggcagaaaatcctcgatcatgcctcgctgatgaca
caccaggccgcgtttaatatgaccattctcgacggcaatgtggtgcttgaggcgcagccg
gacgtggttgtcaccaccgtcgcggaagtggcaatgcacagtttttatcatcaggagatc
ggtggtcagctttctgctgaatcctctcataaaacacagaccaacccgccggccttcggc
tgtacttttgtcgatgtcaccgtggatattccgatgtgtcaggtgaccattaaccggatc
atcaatatgcacgattccggccggatcctgaacccgcagctggcggaaggccaggtccac
ggcggaatgggaatggggatcggctgggcgctgtttgaagagatgctgatcaacgagaaa
tccggggttgttcataacccgaacctgctcgactacaaaatgccgaccatggttgacctg
ccggatctggagtgcgggtttgtcgaaacctacgagccgcagtccgcatacggccataag
tccctgggtgagccgccgattattgcgccggctgccgctatccgtaacgccgtgcgtatg
gcgacgggtatttctgtcaatactatcccgctgacaccaaaacggctgtaccgggaattt
gttaatgccgggcttatcagggggtaa

DBGET integrated database retrieval system