KEGG   Morganella morganii: MU9_2067Help
Entry
MU9_2067          CDS       T02496                                 

Definition
(GenBank) Glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
mmk  Morganella morganii
Pathway
mmk00030  Pentose phosphate pathway
mmk00480  Glutathione metabolism
mmk01100  Metabolic pathways
mmk01110  Biosynthesis of secondary metabolites
mmk01120  Microbial metabolism in diverse environments
mmk01130  Biosynthesis of antibiotics
mmk01200  Carbon metabolism
Module
mmk_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
mmk_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
mmk_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:mmk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MU9_2067
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MU9_2067
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmk04147]
    MU9_2067
Enzymes [BR:mmk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     MU9_2067
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     MU9_2067
Exosome [BR:mmk04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   MU9_2067
  Exosomal proteins of colorectal cancer cells
   MU9_2067
  Exosomal proteins of bladder cancer cells
   MU9_2067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AGG31113
UniProt: J7U532
Position
2294325..2295800
Genome map
AA seq 491 aa AA seqDB search
MALTATVPACDLVIFGTKGDLARRKLLPSLYQLEKAGNIHPETRIIGAGRADWSREEYQK
FVEDAFNTFLNEQLDPVLWERFSARLLFCNLDVNETSHFKSLANIIAENKNTAVYYFAMP
PGTFSAMCKGLGEAHLNKEPSRVVMEKPLGNDLASSQAINTEVAKYFKESQIYRIDHYLG
KETVLNLLALRFANSLFVNNWDNRTIDHVQITVAEEVGIEGRWGYFDKAGQMRDMVQSHL
LQILTMIAMSPPDDLTSDRIRDEKVKVLRSLRTIDITNVREKTVRGQYTAGFVHGEKVPG
YLDEEGANTVSQTETFVAIRADIDDWRWSGVPFYLRTGKRMPSKCSEVVVYFKQPSLNIF
NETYQHLPPNKLTIRLQPDEGIDIEVLNKAPGLDHKHRLQTTKLDLSFSETFNQTHIADA
YERLLLEAMRGIQALFVRRDEVEEAWKWVDSIMHAWAMDNEPPKPYQAGSWGPIASIAMM
ARDGHAWNEVE
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgacagcaacggttcccgcctgtgatttagtcattttcggtaccaaaggcgac
ctcgcacgccgcaagttactcccgtctttatatcagctggaaaaagccggtaatattcat
ccggaaacgcggattatcggggcaggccgtgcggactggtcccgtgaggagtatcagaaa
tttgttgaggatgcgttcaataccttcctcaacgagcaactggatccggtgctctgggaa
cgattcagtgcccgtctgctgttttgtaatctcgatgtgaatgagacctctcatttcaaa
agcctcgccaatattattgcggaaaacaaaaatactgctgtttactatttcgcgatgccg
ccgggcacgttcagcgccatgtgcaaagggctgggtgaagcgcatctgaataaagaaccg
agccgtgtggtgatggaaaaaccactgggtaatgatctggcctcatcacaggcgatcaat
accgaagtagcgaaatattttaaagagagccagatttaccgcatcgaccattatctcggc
aaagaaacggtactgaacctgctggcgctgcgttttgccaattccctgtttgtgaataac
tgggataaccgtaccatcgaccacgtccagatcacggtggcggaagaagtggggattgaa
gggcgctggggttactttgataaagccgggcagatgcgtgacatggtgcagagccatctg
ctgcaaattctgactatgattgccatgtcaccgccggatgacctgaccagtgaccgtatc
cgtgatgagaaagtgaaggtgctgcgctcactgcggaccattgatatcacgaatgtccgt
gaaaaaaccgtacgcgggcaatataccgccgggtttgttcacggcgaaaaagtaccgggt
tatctggatgaagagggcgcgaataccgtcagccagaccgaaacctttgtcgctatccgc
gcggatatcgacgactggcgctggtccggtgtgccgttctatctgcgtaccggaaaacgg
atgccgtcaaaatgttcggaagtggtggtctatttcaaacagccgtccctgaatattttc
aatgaaacctatcagcatctgccgccgaataaactgactatccgtctgcagccggacgaa
ggtattgatattgaagtgctgaacaaagcaccggggctggatcataaacaccgtctgcaa
accaccaagctggatctgagtttctcggaaacgttcaaccagacacatattgcggatgcg
tatgaacgtctgctgctggaagctatgcgcggtattcaggcactgtttgtccgccgtgat
gaagtggaggaagcctggaagtgggtggattctattatgcacgcctgggcaatggataat
gaaccgccgaaaccgtatcaggcaggcagctgggggccgatagcttctatcgccatgatg
gcccgtgacggtcatgcctggaacgaagtggaataa

DBGET integrated database retrieval system