KEGG   Morganella morganii: MU9_2560Help
Entry
MU9_2560          CDS       T02496                                 

Definition
(GenBank) Aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
mmk  Morganella morganii
Pathway
mmk00220  Arginine biosynthesis
mmk00250  Alanine, aspartate and glutamate metabolism
mmk00290  Valine, leucine and isoleucine biosynthesis
mmk01100  Metabolic pathways
mmk01110  Biosynthesis of secondary metabolites
mmk01130  Biosynthesis of antibiotics
mmk01210  2-Oxocarboxylic acid metabolism
mmk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmk00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MU9_2560
   00290 Valine, leucine and isoleucine biosynthesis
    MU9_2560
   00220 Arginine biosynthesis
    MU9_2560
Enzymes [BR:mmk01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     MU9_2560
    2.6.1.66  valine---pyruvate transaminase
     MU9_2560
Amino acid related enzymes [BR:mmk01007]
 Aminotransferase (transaminase)
  Class I
   MU9_2560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Aminotran_MocR Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AGG31605
UniProt: J7U3J7
Position
2809442..2810656
Genome map
AA seq 404 aa AA seqDB search
MNIIKKSSKLDNVCYDIRGPVLKEAKRLEEEGQKVLKLNIGNPAPFGFDAPDEILVDVIR
NLPSSQGYSDSKGLYSARKAIVQFYQERGMRDMTVEDVYIGNGVSELIVQSMQALLNNGD
EMLVPAPDYPLWTGAVSLSGGTAVHYMCDEEQGWMPDIEDIKKKITPRTRGIVVINPNNP
TGAVYSKDLLQEIVELARQNDLIIFADEIYDKILYDDAVHHSIAAMAPDLLTVTFNGLSK
TYRIAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPMQHAIQTAIGGYQSINEFI
HPGGRLYEQRNKAWELINQIPGCSCVKPMGALYMFPKFDAKRFNIHDDQKMILDLLLQEK
VLLVQGTAFNWPEPNHFRIVTLPREDDLEMAINRFGRFLSHYRQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaatataataaagaaatccagcaaactcgataatgtctgttacgacattcgcgggccg
gtgctcaaagaggctaaacgtctcgaagaggaaggccagaaagttctcaaactgaatatc
ggtaacccggcgccgtttggttttgatgccccggacgaaattctggttgatgttatccgt
aatttaccaagctcccagggttacagcgattcaaaaggcctctattccgcccgtaaagcc
attgtccagttctaccaggaacgcggcatgcgcgatatgacggtggaagatgtctatatc
ggtaacggggtttctgaactgattgtgcagtccatgcaggcgctgctgaataacggtgat
gaaatgctggtaccggcaccggattacccgttatggaccggtgcggtctccctctccggc
ggtactgccgtccactatatgtgcgacgaagaacagggctggatgccggacattgaggac
atcaaaaagaaaatcaccccgcgcacccgcggtattgtggtgattaacccgaacaacccg
accggggctgtttacagcaaagatttgttacaggagattgtcgaactcgcccgtcagaat
gacctgatcatttttgctgacgaaatctacgacaaaattctgtatgacgatgccgtccac
cactctatcgccgcaatggcgccggatctgctgaccgtcaccttcaacggcctgtcaaaa
acctaccgtatcgccggtttccgccagggctggatggtcctgaacgggccgaagaaacac
gccaaagggtatattgaagggctggaaatgctcgcgtccatgcgtctgtgtgccaacgtg
ccgatgcagcatgctatccagaccgcaatcggcgggtaccagagcatcaatgagtttatt
catccgggcggccgtctgtatgaacagcgcaacaaagcctgggaactgattaaccagata
ccgggctgctcctgtgtcaaaccgatgggcgcactctatatgttcccgaaatttgatgcc
aagcgctttaatattcacgatgaccagaagatgatcctcgacctgctgttacaggaaaaa
gtactgctggtacagggtactgcctttaactggccggaaccgaaccacttccgtatcgtg
acactgccgcgtgaggatgacctggagatggcgattaaccgcttcgggcgtttcctctct
cactaccgtcagtaa

DBGET integrated database retrieval system