KEGG   Morganella morganii: MU9_318Help
Entry
MU9_318           CDS       T02496                                 

Definition
(GenBank) Glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
mmk  Morganella morganii
Pathway
mmk00471  D-Glutamine and D-glutamate metabolism
mmk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    MU9_318
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mmk01011]
    MU9_318
Enzymes [BR:mmk01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     MU9_318
Peptidoglycan biosynthesis and degradation proteins [BR:mmk01011]
 Precursor biosynthesis
  Racemase
   MU9_318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race DUF116
Motif
Other DBs
NCBI-ProteinID: AGG29364
UniProt: J7TXR9
Position
complement(347465..348331)
Genome map
AA seq 288 aa AA seqDB search
MAIEPLAANTSLQEATTSDPKTRPTVLLFDSGMGGLSVYQEVRQLLPDLHYIYAFDNEAF
PYGEKTEAFIVERVTKIVRQIAQQHPLAVIVIACNTASTITLPALRAMSDIPVVGVVPAI
KPAAKLTRNGLVGLLATRATVKRAYTRELIDRFASECQVSLLGSAELVELAERKLYGEAI
PAGALETILAPWRNMKEPPDTVVLGCTHFPLIAEELKSALPDGTRLVDSGAAIARRVQWL
INNSEKPHHLTAEKNVAYCMRDDETTQKLQPVLQQLGLESLKKLTITG
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaccgctggccgcgaatacttccttacaggaagctacaacttctgatccg
aaaacccgcccgacagtgctgctgtttgactccggcatgggcggtttatctgtctatcag
gaagtaagacaattacttcctgatctccactatatatatgcattcgataatgaggcgttt
ccttacggtgaaaaaaccgaagcctttattgtcgaacgtgtgactaagattgtccgccag
attgctcagcagcatccgctggcagtgattgtcattgcctgtaataccgcaagcaccatt
acgctgcctgcactgcgtgcaatgtctgatattccggtggtcggcgtggttccggcgatt
aaaccggcagcgaaactgacacgcaacggcctggtcgggctgctggcaacgcgggcaacg
gtaaaacgggcttacacccgggaactgattgaccggtttgcttctgagtgtcaggtatca
ctattaggatcggcggagctggtcgaactcgcagagcgcaagctgtatggtgaggcgatt
ccggcaggtgccctggaaactatccttgcgccgtggcggaatatgaaagagccgcctgac
acagtggtactgggatgtacgcattttccgctgattgccgaagaactgaaatcagcatta
cctgacggcacccggctggtggattccggggcggcgattgcccgccgcgtacagtggtta
atcaataacagtgagaaacctcatcacttaaccgcagaaaaaaatgtggcgtattgcatg
cgggatgatgaaacgacacagaaattacagcctgttttgcagcaattgggactcgaatcg
ctgaaaaaactgacgattacaggatga

DBGET integrated database retrieval system