KEGG   Morganella morganii: MU9_369Help
Entry
MU9_369           CDS       T02496                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mmk  Morganella morganii
Pathway
mmk00071  Fatty acid degradation
mmk00280  Valine, leucine and isoleucine degradation
mmk00310  Lysine degradation
mmk00362  Benzoate degradation
mmk00380  Tryptophan metabolism
mmk00620  Pyruvate metabolism
mmk00630  Glyoxylate and dicarboxylate metabolism
mmk00640  Propanoate metabolism
mmk00650  Butanoate metabolism
mmk00900  Terpenoid backbone biosynthesis
mmk01100  Metabolic pathways
mmk01110  Biosynthesis of secondary metabolites
mmk01120  Microbial metabolism in diverse environments
mmk01130  Biosynthesis of antibiotics
mmk01200  Carbon metabolism
mmk01212  Fatty acid metabolism
mmk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mmk00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MU9_369
   00630 Glyoxylate and dicarboxylate metabolism
    MU9_369
   00640 Propanoate metabolism
    MU9_369
   00650 Butanoate metabolism
    MU9_369
  Lipid metabolism
   00071 Fatty acid degradation
    MU9_369
   00072 Synthesis and degradation of ketone bodies
    MU9_369
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MU9_369
   00310 Lysine degradation
    MU9_369
   00380 Tryptophan metabolism
    MU9_369
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MU9_369
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MU9_369
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MU9_369
Enzymes [BR:mmk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MU9_369
Exosome [BR:mmk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MU9_369
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C PilS TraW_N
Motif
Other DBs
NCBI-ProteinID: AGG29415
UniProt: J7SJV1
Position
complement(404195..405376)
Genome map
AA seq 393 aa AA seqDB search
MENIVIVSAVRTAIGNFNGALAGVSAVELGSAVVSALLKKTQLEPGLVDEVIMGNVLQAG
LGQNPARQILLRSGIPESACAFTVNKVCGSGLKSVALGAQAISSGDADIIIAGGTENMSQ
APYLLDSRARWGYRLGDGAVHDVILRDGLLCAENNYHMGITAENIAKAYNLTREEQDALA
LSSQQKAVSAIERGAFKAEIVPVTVKSRKGDIVVDTDEFPKAGSTAEGLAKLRPAFDKAG
TVTAGNASGINDGAAALMLMTETRAKSLGLTPLARIRGYASGGVSPSMMGLGPVPATRKV
LEKTGLSLKDIDLIEANEAFASQFLAVGRDLGFDPDKVNINGGAIALGHPIGASGARILV
TLLHALQAQNKTTGLATLCIGGGQGIAMVIERL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatatcgttattgtcagtgccgtgcgtaccgcaatcggcaactttaacggcgca
ctggcgggtgtcagtgccgtggaactcggctcggcagtggtcagcgcgttactgaaaaaa
acgcagctggaaccggggctggtggatgaagtgattatggggaacgtgctacaggccgga
ctcggacagaaccctgcgcgccagatcctgctgcgcagcggtataccggaaagcgcctgt
gctttcaccgtcaataaagtgtgcggctccggcctgaagagtgttgcgctgggcgcacag
gcgatcagcagcggtgacgcggacattattatcgcgggcggcacggaaaatatgagtcag
gcgccgtatctgctcgacagccgtgcccgctggggttaccgcctgggcgacggtgcagtg
catgatgtgattctgcgtgacgggctgttatgtgccgagaataactatcacatggggatc
acagcggagaacatcgccaaagcctataacctgacccgcgaagagcaggatgcactggca
ctgtcatcacagcagaaagccgtcagcgcgattgagcgcggcgcctttaaggctgaaatc
gtgccggtgacggtgaaaagccgtaaaggggatatcgtggtggataccgatgaattcccg
aaagccggatcaacggcagaagggctggcgaaactgcgcccggcctttgataaagcggga
acggtgactgccggtaatgcctccggtatcaatgacggtgcggcagctctgatgctgatg
acggaaacccgtgctaaatcactgggactgacaccgcttgcccgcatccggggttatgcc
tccggcggggtttcaccgtcgatgatggggctggggccggttccggccacgcggaaagtg
ctggagaaaacggggctgtcactgaaggatatcgatcttatcgaagccaacgaagcattt
gcctcccaatttctcgcggtcggccgtgacctgggttttgatcctgacaaagtaaacatc
aacggcggggcgattgccctgggtcacccgattggtgcgagtggtgcccgtatcctggtg
acactgctgcatgcattacaggctcagaataaaaccaccggtctggcgacactctgtatc
ggtggcgggcaggggatcgcgatggtgattgaacgtctgtaa

DBGET integrated database retrieval system