KEGG   Mycoplasma mycoides subsp. capri LC 95010: MLC_0430Help
Entry
MLC_0430          CDS       T01478                                 

Gene name
recR
Definition
(GenBank) Recombination protein
  KO
K06187  recombination protein RecR
Organism
mml  Mycoplasma mycoides subsp. capri LC 95010
Pathway
mml03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mml00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MLC_0430 (recR)
DNA repair and recombination proteins [BR:mml03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     MLC_0430 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      MLC_0430 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim PHF5 COMM_domain Mcm10 RUN zn-ribbon_14 Rsd_AlgQ
Motif
Other DBs
NCBI-ProteinID: CBW53771
UniProt: F4MNT9
Position
complement(59382..59981)
Genome map
AA seq 199 aa AA seqDB search
MIKMLETTFDEIIESIRTNQGLTKKTSERLLVDLLINKDKLDQFIDQLNKAKQLISTCKI
CGYLSENNKCLVCSLDNRNQNTICIVSTILDAKNIENTNKYKGVYHILNGEINLNKNITF
DKLNISSIFKRINDNTEIILALNSTFEGELTANYLYKLLSTKNIKITRLAKGIPMGASLD
YMDEFTLQSAFLNRKKYGE
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtgattaaaatgttagaaactacatttgatgaaattattgaatcaattagaacaaatcaa
ggtttaactaaaaaaacatcagaaagattattagttgatttattaataaataaagataaa
ctagatcaatttattgatcaattaaataaagcaaaacaattaatttcaacttgcaaaata
tgtgggtatttaagtgaaaataataaatgtttagtatgtagtttagataatagaaatcaa
aatacaatttgtatagtttcaacaattttagatgcaaaaaacattgaaaatactaataaa
tacaaaggggtttatcatattttaaatggtgaaattaatctaaataaaaacattacattt
gataaattaaatattagttctatttttaaaaggattaatgataatactgaaattatttta
gctttaaattctacttttgaaggtgagttaactgctaattatttatacaaattactaagt
actaaaaacattaaaattacaagattagctaaaggaataccaatgggagctagtttagat
tatatggatgaattcactttacaaagtgcatttcttaatagaaaaaaatatggagaataa

DBGET integrated database retrieval system