KEGG   Mycoplasma mycoides subsp. capri LC 95010: MLC_1070Help
Entry
MLC_1070          CDS       T01478                                 

Gene name
galU
Definition
(GenBank) UTP glucose 1 phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mml  Mycoplasma mycoides subsp. capri LC 95010
Pathway
mml00040  Pentose and glucuronate interconversions
mml00052  Galactose metabolism
mml00500  Starch and sucrose metabolism
mml00520  Amino sugar and nucleotide sugar metabolism
mml01100  Metabolic pathways
mml01130  Biosynthesis of antibiotics
Module
mml_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mml00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MLC_1070 (galU)
   00052 Galactose metabolism
    MLC_1070 (galU)
   00500 Starch and sucrose metabolism
    MLC_1070 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    MLC_1070 (galU)
Enzymes [BR:mml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MLC_1070 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD Plasmod_Pvs28
Motif
Other DBs
NCBI-ProteinID: CBW53835
UniProt: F4MP03
Position
complement(141036..141908)
Genome map
AA seq 290 aa AA seqDB search
MTIRKAVIPCAGFGTRFLPFTKSQAKEMLPIIDTPTIEYIVKEAVDSGIKEILIVLNDKK
SEIMNYFSRNIELERFLYNKDKINELEQIKTKYDADIHYIMQDEPLGLGHAISLCKGFIN
NESFAVLLGDDLFKCQTPAIKQLMDLYEEKHSTILGTILIDKKDCKKYGICKTESSNDNV
YKVCSVVEKPDEQNAPSNVAIAGRYILTPEIFNYLDLQLKGETGEIELTDSILRTIKDVD
CYAKVIDGKRYDIGNKLGYLEAFVDFASNRDDTKNEFIKIVKKLNEEENL
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaccattagaaaagctgttattccttgtgctggttttggaactagatttttacctttt
acaaaatcacaagcaaaagaaatgttacccattattgataccccaactatagaatatatt
gtaaaagaagctgttgatagtggtattaaagaaatattaatagttttaaatgataaaaaa
agtgaaataatgaactattttagtagaaacattgagcttgaacgttttttatataataaa
gataaaatcaatgagcttgaacaaattaaaactaaatatgatgctgatatccactatata
atgcaagatgaaccactaggtttaggacatgctatttctttatgtaaaggttttataaat
aatgagtcttttgctgtgcttttaggagatgatttatttaaatgtcaaactcctgctatt
aaacaattaatggacttatatgaagaaaaacattcaactattttaggaacaattttaatt
gataaaaaagattgtaaaaagtatggtatttgtaaaactgaatcaagtaatgataatgtt
tataaagtttgttctgtagttgaaaaaccagatgaacaaaacgctccaagtaatgttgca
attgctggaagatatattttaactcctgaaatttttaactatttagatttacaacttaaa
ggtgaaactggagaaattgaattaactgattcaattttaagaactattaaagatgttgat
tgttatgcaaaagttattgatggaaaaagatatgatattggaaacaaattaggttattta
gaagcttttgttgactttgcttcaaacagagatgacacaaaaaatgaatttattaaaatt
gttaaaaaattaaatgaagaagaaaatttataa

DBGET integrated database retrieval system