KEGG   Mycoplasma mycoides subsp. capri LC 95010: MLC_7440Help
Entry
MLC_7440          CDS       T01478                                 

Gene name
tpi
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mml  Mycoplasma mycoides subsp. capri LC 95010
Pathway
mml00010  Glycolysis / Gluconeogenesis
mml00051  Fructose and mannose metabolism
mml01100  Metabolic pathways
mml01110  Biosynthesis of secondary metabolites
mml01120  Microbial metabolism in diverse environments
mml01130  Biosynthesis of antibiotics
mml01200  Carbon metabolism
mml01230  Biosynthesis of amino acids
Module
mml_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mml_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mml00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MLC_7440 (tpi)
   00051 Fructose and mannose metabolism
    MLC_7440 (tpi)
   00562 Inositol phosphate metabolism
    MLC_7440 (tpi)
Enzymes [BR:mml01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MLC_7440 (tpi)
Exosome [BR:mml04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MLC_7440 (tpi)
  Exosomal proteins of bladder cancer cells
   MLC_7440 (tpi)
  Exosomal proteins of melanoma cells
   MLC_7440 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Terminase_3 Aldolase
Motif
Other DBs
NCBI-ProteinID: CBW54474
UniProt: F4MQU1
Position
930113..930859
Genome map
AA seq 248 aa AA seqDB search
MKKKVIFGNWKMNGTNESLTDFLNQVDNKIDSSKIIAGLAVPYVMLQTGLKLAKNVKIAA
QNVHYKDKGAYTGEISTTMLKEIGVEYVIIGHSERREMFNETDLDVNKKAKVLLENNITP
IICCGETLQTKESGKTIEFVNNQINIMFEGIKKEEAIKAIIAYEPIWAIGTGKTATSSDA
EEVCKQIRNNLTKIYDKDTAEQIIIQYGGSVKPSNIQEYLKMPNIDGALVGGASLLANDY
LGLVNYNE
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaaggtaatttttggtaattgaaaaatgaatgggactaatgaaagtttgaca
gattttttaaaccaagtagataataaaatagatagttcaaaaattatagcaggattagct
gtaccttatgtaatgttacaaactgggctaaaacttgcaaaaaatgttaaaatagctgct
caaaacgtacattataaagataagggtgcttatactggagaaatttcaactacaatgcta
aaagaaatcggagttgaatatgtaattattggacattctgaaagaagagaaatgtttaat
gaaactgatttagatgttaataaaaaagctaaagttttattagaaaataatataactcct
attatttgttgtggtgaaactttacaaactaaagaaagtggaaaaactattgaatttgta
aataatcaaattaatataatgtttgaaggtattaaaaaagaagaagcaatcaaagcaatt
attgcttatgaaccaatttgagcaattggtactggaaaaacagcaacaagtagcgatgct
gaagaagtatgtaaacaaatcagaaataatttaacaaaaatttatgataaagatacagct
gaacaaattattattcagtatggtggaagtgttaaaccatcaaatattcaagaatattta
aaaatgccaaatattgatggagctttagttggaggagcttctttattagctaatgattat
ttaggtttagttaactataatgaataa

DBGET integrated database retrieval system