KEGG   Mycobacterium sp. MOTT36Y: W7S_00705Help
Entry
W7S_00705         CDS       T02113                                 

Definition
(GenBank) haloacid dehalogenase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
mmm00361  Chlorocyclohexane and chlorobenzene degradation
mmm00625  Chloroalkane and chloroalkene degradation
mmm01100  Metabolic pathways
mmm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mmm00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    W7S_00705
   00361 Chlorocyclohexane and chlorobenzene degradation
    W7S_00705
Enzymes [BR:mmm01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     W7S_00705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: AFJ33128
UniProt: I2A754
Position
complement(139865..140620)
Genome map
AA seq 251 aa AA seqDB search
MTDYRSPSTGRVVRAVLFDTFGTVVDWRSGIAASVRRFAQRQHIDVDPDAFALEWRSRYL
PSMSEIRSGRREFVSLDVLHRENLVASLAKFGVSADALPCDEVQALARSWRWLPPWPDSV
DGIAVMKRHVIVGPLSNGNTGLLVEMAKYAGLPWDVVLGSDVSQAYKPDPRAYQTPARLL
GLEPGEVMLVAAHTADLEAARDSGLATGFVARPQEYGPDPVPAPAPPGPWDVSGTSLVEL
AGSLFGAQGRP
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaccgactaccgctcaccgtcgaccggtcgggtagtgcgtgcagttctgttcgatacg
ttcggaacggtcgtcgactggcgttcggggatcgccgcctcggtacggcgtttcgcgcag
cgccaacacatcgacgtcgaccccgacgcgttcgcgctggagtggcgcagtcgatacctg
ccctccatgtccgagattcgctcgggccgacgggaattcgtgtcgctggacgttctgcat
cgagagaacctcgtcgcatcgctcgcgaagttcggcgtcagtgccgacgcgctgccctgc
gacgaggtgcaggcactcgcccggtcgtggcgctggctgccaccgtggccggacagcgtc
gacggcatcgcggtcatgaagcggcacgtcatcgtcgggcccttgtccaacggcaacacc
gggctgctggtcgagatggcgaagtacgcgggcctgccctgggatgtggtcctgggttcc
gacgtcagtcaggcctacaagcccgacccgcgggcctaccagactcccgcgcgattgctg
ggcctggagcccggtgaggtgatgctggtggcggcgcacaccgccgacctcgaggcggcc
cgcgatagcggcctggcgaccggtttcgtcgcgcgcccgcaggagtacgggccggacccg
gtgcccgcccccgcgcccccgggcccctgggacgtctcaggcacctcactggtcgaactg
gcgggctcactgttcggtgcgcagggccgaccttga

DBGET integrated database retrieval system