KEGG   Mycobacterium sp. MOTT36Y: W7S_03540Help
Entry
W7S_03540         CDS       T02113                                 

Definition
(GenBank) hypothetical protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
mmm00071  Fatty acid degradation
mmm00072  Synthesis and degradation of ketone bodies
mmm00280  Valine, leucine and isoleucine degradation
mmm00310  Lysine degradation
mmm00362  Benzoate degradation
mmm00380  Tryptophan metabolism
mmm00620  Pyruvate metabolism
mmm00630  Glyoxylate and dicarboxylate metabolism
mmm00640  Propanoate metabolism
mmm00650  Butanoate metabolism
mmm00900  Terpenoid backbone biosynthesis
mmm01100  Metabolic pathways
mmm01110  Biosynthesis of secondary metabolites
mmm01120  Microbial metabolism in diverse environments
mmm01130  Biosynthesis of antibiotics
mmm01200  Carbon metabolism
mmm01212  Fatty acid metabolism
mmm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mmm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    W7S_03540
   00630 Glyoxylate and dicarboxylate metabolism
    W7S_03540
   00640 Propanoate metabolism
    W7S_03540
   00650 Butanoate metabolism
    W7S_03540
  09103 Lipid metabolism
   00071 Fatty acid degradation
    W7S_03540
   00072 Synthesis and degradation of ketone bodies
    W7S_03540
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    W7S_03540
   00310 Lysine degradation
    W7S_03540
   00380 Tryptophan metabolism
    W7S_03540
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    W7S_03540
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    W7S_03540
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    W7S_03540
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmm04147]
    W7S_03540
Enzymes [BR:mmm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     W7S_03540
Exosome [BR:mmm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   W7S_03540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt Gemin7
Motif
Other DBs
NCBI-ProteinID: AFJ33691
UniProt: I2A8R7
Position
708195..709334
Genome map
AA seq 379 aa AA seqDB search
MPEAVIVSALRTPIGTARKGTLRDTSAFDLAHYVVTEAATDLDPAQVDDVILGEGLYGGG
VLARHAAITAGLTQVPGLANNRHCAAGQAAVQSAAASVRAGMDELVIAGGVNSASTSPRS
RLQVDGDWVDWFPPTHPDRPDAPNMDMSITVGWNAAVKAGVTREEMDAWALRSHRNAIAA
IDEGRFKEEIVPIDTPHGLFSVDEHPRRDTSMEKLAALKPLHPEIEGFSITAGNACGAND
GAAALTIASDRFGLPALATIRSWASVGVDPAVTGLAPVEAIPKALGRAGLSVADVDLFEI
NEAFAAMCVATIKLLELDPEKVNVSGSGCSLGHPVAATGARMLVTLVHELRRRGGGIGVA
AMCAGGGMGSATVIEVAAP
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgaagccgtcatcgtgtccgccctgcgcacccccatcggcaccgcacgcaagggg
accctgcgcgacaccagcgcgttcgatctggcgcactacgtcgtcaccgaagcggcaacg
gatctcgacccggcgcaggtcgacgacgtgatcctgggcgaaggcctctacggaggcggc
gtgctggcgcgccacgcggccatcaccgcgggcctgacccaggtgcccggcttggccaac
aatcgccactgcgcggcgggccaggcggccgtgcagagcgcggcggcgagcgtgcgcgcg
ggaatggacgagctcgtgatcgccggcggcgtgaattcggcgtcgacgtcgccgcggtcg
cggttgcaggtggacggcgactgggtcgactggtttccccccacccacccggaccgcccc
gacgcgcccaacatggacatgtcgatcaccgtcggctggaacgccgcggtcaaggccggc
gtgacccgcgaggagatggacgcctgggcgctgcgctcgcaccgcaacgccatcgccgcc
atcgacgaaggccgtttcaaagaggagatcgtccccatcgacaccccacacgggttgttc
tcggtcgacgaacacccacgacgcgacaccagcatggagaagttggccgcgctcaagccg
ctgcacccggaaatcgagggcttttccatcaccgccggcaacgcctgcggtgccaacgac
ggggccgccgcgttgacgatcgccagcgaccggttcgggctgccggcgctggccaccatc
cggtcctgggcgtcggtcggcgtcgacccggcggtcaccggtttggcgccggtcgaggcg
atcccgaaagctcttggccgcgctggcctttcggtcgccgacgtggacctgtttgaaatc
aacgaggccttcgcggcgatgtgcgtggccaccatcaagctcctcgaacttgaccccgaa
aaggtcaacgtcagcggcagcggctgctcgctggggcatcccgtcgcggcgaccggagcc
cggatgctcgtcaccctggtgcacgaattgcgccgccgcggcggcgggatcggtgtcgcg
gcgatgtgcgcgggcggcggaatgggctcggcgacggtgatcgaggtcgcggctccataa

DBGET integrated database retrieval system